BLASTX nr result
ID: Scutellaria24_contig00024494
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00024494 (218 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK79031.1| cytochrome P450 CYP736A54 [Bupleurum chinense] 72 4e-11 ref|XP_002280620.1| PREDICTED: cytochrome P450 71A1 [Vitis vinif... 72 6e-11 ref|XP_003630098.1| Cytochrome P450 [Medicago truncatula] gi|355... 70 2e-10 ref|XP_003524281.1| PREDICTED: cytochrome P450 71A1-like [Glycin... 70 2e-10 ref|XP_003531374.1| PREDICTED: cytochrome P450 71A1-like [Glycin... 69 3e-10 >gb|AFK79031.1| cytochrome P450 CYP736A54 [Bupleurum chinense] Length = 497 Score = 72.4 bits (176), Expect = 4e-11 Identities = 30/57 (52%), Positives = 45/57 (78%) Frame = +1 Query: 1 TMMSIMRTKDTEFQFDRRHVKAIMLDMLATSMDRGASTVEWLISELLKNPTIMKKVQ 171 TM+ IM++ ++EF+FDR HVKA ++DM A S D ++T+EW +SELL++P +M KVQ Sbjct: 268 TMLDIMKSGESEFEFDRSHVKATLMDMFAASADTSSTTIEWTLSELLRHPRVMNKVQ 324 >ref|XP_002280620.1| PREDICTED: cytochrome P450 71A1 [Vitis vinifera] Length = 498 Score = 71.6 bits (174), Expect = 6e-11 Identities = 32/56 (57%), Positives = 44/56 (78%) Frame = +1 Query: 4 MMSIMRTKDTEFQFDRRHVKAIMLDMLATSMDRGASTVEWLISELLKNPTIMKKVQ 171 M+ M +K+ EFQ +R ++KA++LDMLA SMD A+ +EW ++ELLKNP IMKKVQ Sbjct: 271 MLGYMGSKENEFQIERSNIKALVLDMLAGSMDTSATAIEWALAELLKNPRIMKKVQ 326 >ref|XP_003630098.1| Cytochrome P450 [Medicago truncatula] gi|355524120|gb|AET04574.1| Cytochrome P450 [Medicago truncatula] Length = 477 Score = 70.1 bits (170), Expect = 2e-10 Identities = 30/56 (53%), Positives = 45/56 (80%) Frame = +1 Query: 4 MMSIMRTKDTEFQFDRRHVKAIMLDMLATSMDRGASTVEWLISELLKNPTIMKKVQ 171 M+ + T+++E++ +R ++KAI+LDMLA SMD A+ +EW ISEL+KNP +MKKVQ Sbjct: 266 MLGFLGTQESEYRIERPNIKAILLDMLAGSMDTSATAIEWAISELIKNPIVMKKVQ 321 >ref|XP_003524281.1| PREDICTED: cytochrome P450 71A1-like [Glycine max] Length = 536 Score = 69.7 bits (169), Expect = 2e-10 Identities = 30/56 (53%), Positives = 45/56 (80%) Frame = +1 Query: 4 MMSIMRTKDTEFQFDRRHVKAIMLDMLATSMDRGASTVEWLISELLKNPTIMKKVQ 171 M+ + T+++E++ +R ++KAI+LDMLA SMD A+ +EW +SELLKNP +MKKVQ Sbjct: 306 MLDFVGTEESEYRIERPNIKAILLDMLAGSMDTSATAIEWTLSELLKNPRVMKKVQ 361 >ref|XP_003531374.1| PREDICTED: cytochrome P450 71A1-like [Glycine max] Length = 493 Score = 69.3 bits (168), Expect = 3e-10 Identities = 29/56 (51%), Positives = 45/56 (80%) Frame = +1 Query: 4 MMSIMRTKDTEFQFDRRHVKAIMLDMLATSMDRGASTVEWLISELLKNPTIMKKVQ 171 M+ + T+++E++ +R ++KAI+LDMLA SMD A+ +EW +SELLKNP +MKK+Q Sbjct: 266 MLGFLGTEESEYRIERSNIKAILLDMLAGSMDTSATAIEWTLSELLKNPRVMKKLQ 321