BLASTX nr result
ID: Scutellaria24_contig00024413
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00024413 (348 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003631607.1| PREDICTED: SWI/SNF complex subunit SWI3D-lik... 56 4e-06 >ref|XP_003631607.1| PREDICTED: SWI/SNF complex subunit SWI3D-like [Vitis vinifera] Length = 1012 Score = 55.8 bits (133), Expect = 4e-06 Identities = 37/86 (43%), Positives = 46/86 (53%), Gaps = 2/86 (2%) Frame = -2 Query: 338 SEQSMSRWRGGGLKRKSTSINSSGGDLASQTTSSKRQFRDKP--PPCPPIHMNGPCTRAR 165 SE SR R GG KRKS +++ AS +T SKR R+K PP IH NGPCTRAR Sbjct: 32 SEPPSSRRRAGGQKRKSNNLS------ASNSTPSKRLAREKALAPPLASIH-NGPCTRAR 84 Query: 164 VQPFNINSLSEVALVKSEVETLLKEP 87 P N++S + S L +P Sbjct: 85 QSPNNVSSAAAATAAASGALQKLDQP 110