BLASTX nr result
ID: Scutellaria24_contig00024335
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00024335 (308 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003632692.1| PREDICTED: putative pentatricopeptide repeat... 152 2e-35 emb|CBI29893.3| unnamed protein product [Vitis vinifera] 152 2e-35 ref|XP_002322694.1| predicted protein [Populus trichocarpa] gi|2... 147 9e-34 ref|XP_003518062.1| PREDICTED: putative pentatricopeptide repeat... 144 6e-33 ref|NP_187990.1| pentatricopeptide repeat-containing protein [Ar... 140 1e-31 >ref|XP_003632692.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g13770, mitochondrial-like [Vitis vinifera] Length = 1053 Score = 152 bits (385), Expect = 2e-35 Identities = 73/102 (71%), Positives = 87/102 (85%) Frame = +1 Query: 1 VILCNMYASNGRWGEVWKTREVMKEKAVMKEPGMSWIEFGQTLHTFYASDRSHPQMEEIR 180 VIL N+YAS GRW +V RE+MKEKAV+KEPG SWIE QTLHTF+ASDRSHP+ EE+ Sbjct: 888 VILSNLYASAGRWDDVRTVRELMKEKAVIKEPGRSWIELDQTLHTFHASDRSHPRKEEVF 947 Query: 181 AKVREMSNRIKAAGYAPDLTCVLHDVNEEQKEKILLGHSEKL 306 AKVRE+S +IK AGY P+L+CVL+DV++EQKEKIL GHSEKL Sbjct: 948 AKVRELSIKIKEAGYVPELSCVLYDVDDEQKEKILQGHSEKL 989 >emb|CBI29893.3| unnamed protein product [Vitis vinifera] Length = 784 Score = 152 bits (385), Expect = 2e-35 Identities = 73/102 (71%), Positives = 87/102 (85%) Frame = +1 Query: 1 VILCNMYASNGRWGEVWKTREVMKEKAVMKEPGMSWIEFGQTLHTFYASDRSHPQMEEIR 180 VIL N+YAS GRW +V RE+MKEKAV+KEPG SWIE QTLHTF+ASDRSHP+ EE+ Sbjct: 421 VILSNLYASAGRWDDVRTVRELMKEKAVIKEPGRSWIELDQTLHTFHASDRSHPRKEEVF 480 Query: 181 AKVREMSNRIKAAGYAPDLTCVLHDVNEEQKEKILLGHSEKL 306 AKVRE+S +IK AGY P+L+CVL+DV++EQKEKIL GHSEKL Sbjct: 481 AKVRELSIKIKEAGYVPELSCVLYDVDDEQKEKILQGHSEKL 522 >ref|XP_002322694.1| predicted protein [Populus trichocarpa] gi|222867324|gb|EEF04455.1| predicted protein [Populus trichocarpa] Length = 586 Score = 147 bits (371), Expect = 9e-34 Identities = 70/102 (68%), Positives = 83/102 (81%) Frame = +1 Query: 1 VILCNMYASNGRWGEVWKTREVMKEKAVMKEPGMSWIEFGQTLHTFYASDRSHPQMEEIR 180 VIL N+YAS GRW +V RE+M EKAV+KEPG SWIE QT+HTFYASDRSHP+ EE+ Sbjct: 421 VILSNLYASAGRWEDVRNVRELMMEKAVIKEPGRSWIELDQTIHTFYASDRSHPRREEVF 480 Query: 181 AKVREMSNRIKAAGYAPDLTCVLHDVNEEQKEKILLGHSEKL 306 KVRE+ + K +GY PD +CVL+DV+EEQKEKILLGHSEKL Sbjct: 481 LKVRELLVKFKESGYVPDQSCVLYDVDEEQKEKILLGHSEKL 522 >ref|XP_003518062.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g13770, mitochondrial-like [Glycine max] Length = 634 Score = 144 bits (364), Expect = 6e-33 Identities = 70/102 (68%), Positives = 81/102 (79%) Frame = +1 Query: 1 VILCNMYASNGRWGEVWKTREVMKEKAVMKEPGMSWIEFGQTLHTFYASDRSHPQMEEIR 180 VIL N+YAS GRW +V R +M +KAV KEPG SWIE Q LHTF+ASD SHP+ EE+ Sbjct: 469 VILSNLYASAGRWEDVRSLRNLMLKKAVTKEPGRSWIELDQVLHTFHASDCSHPRREEVS 528 Query: 181 AKVREMSNRIKAAGYAPDLTCVLHDVNEEQKEKILLGHSEKL 306 AKV+E+S R K AGY PDL+CVLHDV+EEQKEKILL HSEKL Sbjct: 529 AKVQELSARFKEAGYVPDLSCVLHDVDEEQKEKILLSHSEKL 570 >ref|NP_187990.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75273354|sp|Q9LIC3.1|PP227_ARATH RecName: Full=Putative pentatricopeptide repeat-containing protein At3g13770, mitochondrial; Flags: Precursor gi|9294022|dbj|BAB01925.1| selenium-binding protein-like [Arabidopsis thaliana] gi|332641888|gb|AEE75409.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 628 Score = 140 bits (352), Expect = 1e-31 Identities = 65/102 (63%), Positives = 84/102 (82%) Frame = +1 Query: 1 VILCNMYASNGRWGEVWKTREVMKEKAVMKEPGMSWIEFGQTLHTFYASDRSHPQMEEIR 180 VIL N+YAS GRW +V R +M +KAV KEPG SWI+ QTLH F+A+DR+HP+ EE+ Sbjct: 463 VILSNLYASAGRWADVNNVRAMMMQKAVTKEPGRSWIQHEQTLHYFHANDRTHPRREEVL 522 Query: 181 AKVREMSNRIKAAGYAPDLTCVLHDVNEEQKEKILLGHSEKL 306 AK++E+S ++K AGY PDL+CVL+DV+EEQKEK+LLGHSEKL Sbjct: 523 AKMKEISIKMKQAGYVPDLSCVLYDVDEEQKEKMLLGHSEKL 564