BLASTX nr result
ID: Scutellaria24_contig00024268
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00024268 (226 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004163534.1| PREDICTED: FACT complex subunit SSRP1-like, ... 72 5e-11 ref|XP_004147459.1| PREDICTED: FACT complex subunit SSRP1-like [... 72 5e-11 ref|XP_003521979.1| PREDICTED: FACT complex subunit SSRP1-like [... 72 6e-11 ref|XP_003517023.1| PREDICTED: FACT complex subunit SSRP1-like [... 70 2e-10 sp|O04235.1|SSRP1_VICFA RecName: Full=FACT complex subunit SSRP1... 70 2e-10 >ref|XP_004163534.1| PREDICTED: FACT complex subunit SSRP1-like, partial [Cucumis sativus] Length = 303 Score = 72.0 bits (175), Expect = 5e-11 Identities = 32/48 (66%), Positives = 39/48 (81%) Frame = +1 Query: 1 RWNKMTADEKAPYEAKARADKKRYTDEISGYKNPQSSNIDSADVPGSS 144 +WNKM+A+EK PYE+KAR DKKRY +EISGYKNPQ NIDS + S+ Sbjct: 256 KWNKMSAEEKEPYESKARDDKKRYKEEISGYKNPQPMNIDSGNESDSA 303 >ref|XP_004147459.1| PREDICTED: FACT complex subunit SSRP1-like [Cucumis sativus] Length = 642 Score = 72.0 bits (175), Expect = 5e-11 Identities = 32/48 (66%), Positives = 39/48 (81%) Frame = +1 Query: 1 RWNKMTADEKAPYEAKARADKKRYTDEISGYKNPQSSNIDSADVPGSS 144 +WNKM+A+EK PYE+KAR DKKRY +EISGYKNPQ NIDS + S+ Sbjct: 595 KWNKMSAEEKEPYESKARDDKKRYKEEISGYKNPQPMNIDSGNESDSA 642 >ref|XP_003521979.1| PREDICTED: FACT complex subunit SSRP1-like [Glycine max] Length = 614 Score = 71.6 bits (174), Expect = 6e-11 Identities = 32/48 (66%), Positives = 38/48 (79%) Frame = +1 Query: 1 RWNKMTADEKAPYEAKARADKKRYTDEISGYKNPQSSNIDSADVPGSS 144 +W K++A+EK PYEAKAR DKKRY DEISGYKNPQ NIDS + S+ Sbjct: 567 KWKKLSAEEKEPYEAKAREDKKRYMDEISGYKNPQPMNIDSGNESDSA 614 >ref|XP_003517023.1| PREDICTED: FACT complex subunit SSRP1-like [Glycine max] Length = 640 Score = 70.1 bits (170), Expect = 2e-10 Identities = 31/48 (64%), Positives = 37/48 (77%) Frame = +1 Query: 1 RWNKMTADEKAPYEAKARADKKRYTDEISGYKNPQSSNIDSADVPGSS 144 +W K++ +EK PYEAKAR DKKRY DEISGYKNPQ NIDS + S+ Sbjct: 593 KWKKLSVEEKEPYEAKAREDKKRYKDEISGYKNPQPMNIDSGNESDSA 640 >sp|O04235.1|SSRP1_VICFA RecName: Full=FACT complex subunit SSRP1; AltName: Full=Facilitates chromatin transcription complex subunit SSRP1; AltName: Full=Recombination signal sequence recognition protein 1 gi|2104679|emb|CAA66480.1| transcription factor [Vicia faba var. minor] Length = 642 Score = 69.7 bits (169), Expect = 2e-10 Identities = 30/48 (62%), Positives = 38/48 (79%) Frame = +1 Query: 1 RWNKMTADEKAPYEAKARADKKRYTDEISGYKNPQSSNIDSADVPGSS 144 +W ++A+EK PYEAKA+ADKKRY DEISGYKNPQ N+DS + S+ Sbjct: 595 KWKNLSAEEKEPYEAKAQADKKRYKDEISGYKNPQPMNVDSGNESDSA 642