BLASTX nr result
ID: Scutellaria24_contig00024092
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00024092 (366 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK36364.1| unknown [Medicago truncatula] 55 4e-06 ref|XP_003536644.1| PREDICTED: tetratricopeptide repeat protein ... 55 4e-06 ref|XP_003555936.1| PREDICTED: tetratricopeptide repeat protein ... 55 8e-06 >gb|AFK36364.1| unknown [Medicago truncatula] Length = 115 Score = 55.5 bits (132), Expect = 4e-06 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = +3 Query: 6 YQFRLVRVDFLEQVLVNGKTLPPQHSVQTSIYAQNK 113 YQF+ +R+DF EQVLVNGK L PQ +++TSIYAQ+K Sbjct: 79 YQFKSIRLDFYEQVLVNGKALTPQQAIRTSIYAQHK 114 >ref|XP_003536644.1| PREDICTED: tetratricopeptide repeat protein 5-like [Glycine max] Length = 417 Score = 55.5 bits (132), Expect = 4e-06 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = +3 Query: 6 YQFRLVRVDFLEQVLVNGKTLPPQHSVQTSIYAQNK 113 YQF+ +R+DF EQVLVNGK L PQ +++TSIYAQ+K Sbjct: 381 YQFKSIRLDFYEQVLVNGKALTPQQAIRTSIYAQHK 416 >ref|XP_003555936.1| PREDICTED: tetratricopeptide repeat protein 5-like [Glycine max] Length = 416 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +3 Query: 6 YQFRLVRVDFLEQVLVNGKTLPPQHSVQTSIYAQNK 113 YQF+ +R+DF EQVLVNGK L PQ +V TSIYAQ+K Sbjct: 380 YQFKSIRLDFYEQVLVNGKALTPQQAVGTSIYAQHK 415