BLASTX nr result
ID: Scutellaria24_contig00024035
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00024035 (533 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002330744.1| predicted protein [Populus trichocarpa] gi|2... 47 3e-08 >ref|XP_002330744.1| predicted protein [Populus trichocarpa] gi|222872520|gb|EEF09651.1| predicted protein [Populus trichocarpa] Length = 354 Score = 47.0 bits (110), Expect(2) = 3e-08 Identities = 21/40 (52%), Positives = 23/40 (57%) Frame = +1 Query: 178 ESGMKKKWRKLVKNSLLWWDYRDHKSKGLVNESFPDFKHK 297 ESG W L++N WWDYR K GLV PDFKHK Sbjct: 202 ESG-SNSWTDLLENPNQWWDYRSSKRSGLVKPKHPDFKHK 240 Score = 35.8 bits (81), Expect(2) = 3e-08 Identities = 17/44 (38%), Positives = 27/44 (61%), Gaps = 1/44 (2%) Frame = +2 Query: 29 ELAHVVAYHVIENSCVLVSGRLSTDPEPF-QLSDSVVKLVLLQT 157 +LAH+ A H+ + V + G+LSTDP PF ++ D VL+ + Sbjct: 131 DLAHIAASHLKKGDFVYIDGQLSTDPPPFPEMQDQTQVQVLVNS 174