BLASTX nr result
ID: Scutellaria24_contig00024023
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00024023 (690 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528826.1| Kinesin heavy chain, putative [Ricinus commu... 58 2e-06 >ref|XP_002528826.1| Kinesin heavy chain, putative [Ricinus communis] gi|223531738|gb|EEF33560.1| Kinesin heavy chain, putative [Ricinus communis] Length = 911 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/43 (60%), Positives = 34/43 (79%) Frame = +2 Query: 170 EVAAPNAELFEEPENTCSRELRIQNIFTLCGNYRELTQHSNTK 298 E ++ N E F+ + + SR +RIQNIFTLCGNYREL+QHSNT+ Sbjct: 647 EASSRNVEEFDNADASSSRLVRIQNIFTLCGNYRELSQHSNTR 689