BLASTX nr result
ID: Scutellaria24_contig00024020
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00024020 (277 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002303376.1| predicted protein [Populus trichocarpa] gi|2... 93 3e-17 ref|XP_002326472.1| predicted protein [Populus trichocarpa] gi|2... 81 8e-14 ref|XP_002531784.1| transferase, putative [Ricinus communis] gi|... 79 3e-13 ref|XP_002873068.1| hypothetical protein ARALYDRAFT_324948 [Arab... 64 1e-08 ref|NP_195909.1| HXXXD-type acyl-transferase-like protein [Arabi... 64 2e-08 >ref|XP_002303376.1| predicted protein [Populus trichocarpa] gi|222840808|gb|EEE78355.1| predicted protein [Populus trichocarpa] Length = 347 Score = 92.8 bits (229), Expect = 3e-17 Identities = 45/87 (51%), Positives = 64/87 (73%) Frame = -1 Query: 262 SPKFPSKLDVEGIQSIVPTKPTDPRQSCKIHVPQDLGSAALLQRRFHLLLGYTKGYDEDS 83 S +F K+ +EG+Q++ P+K TDPR++C + V +D S+ + Q ++L Y K +EDS Sbjct: 7 SSEFVHKVQIEGVQTVAPSKVTDPRETCLVSV-KDPVSSDIFQGCLSIVLCYNKAVEEDS 65 Query: 82 GWLVAGLIKESLGRALMEQPLLAGRLR 2 GWLVAG IKESLGRAL +QP+L+GRLR Sbjct: 66 GWLVAGWIKESLGRALQDQPMLSGRLR 92 >ref|XP_002326472.1| predicted protein [Populus trichocarpa] gi|222833794|gb|EEE72271.1| predicted protein [Populus trichocarpa] Length = 157 Score = 81.3 bits (199), Expect = 8e-14 Identities = 39/84 (46%), Positives = 57/84 (67%) Frame = -1 Query: 256 KFPSKLDVEGIQSIVPTKPTDPRQSCKIHVPQDLGSAALLQRRFHLLLGYTKGYDEDSGW 77 +F K+ +E +Q++ P+ TDPR+ C + V +GS + + +++L Y K +EDSGW Sbjct: 9 EFARKVQIEAVQTVSPSSVTDPREICLVSVKDPVGSN-IFRGCLNIVLYYNKAGEEDSGW 67 Query: 76 LVAGLIKESLGRALMEQPLLAGRL 5 LVAG IKESLGR L +QP+L GRL Sbjct: 68 LVAGWIKESLGRVLSDQPMLGGRL 91 >ref|XP_002531784.1| transferase, putative [Ricinus communis] gi|223528577|gb|EEF30598.1| transferase, putative [Ricinus communis] Length = 373 Score = 79.3 bits (194), Expect = 3e-13 Identities = 40/81 (49%), Positives = 56/81 (69%) Frame = -1 Query: 244 KLDVEGIQSIVPTKPTDPRQSCKIHVPQDLGSAALLQRRFHLLLGYTKGYDEDSGWLVAG 65 K +E IQ++ P TDPRQ ++ V ++ + + + F+++L Y K ++DSGWLVAG Sbjct: 14 KPQIEAIQTVPPFVVTDPRQFRQVSVAKEPIGSGIFKGCFNIVLCYNKAMEKDSGWLVAG 73 Query: 64 LIKESLGRALMEQPLLAGRLR 2 IKESL RAL EQPLL+GRLR Sbjct: 74 WIKESLARALKEQPLLSGRLR 94 >ref|XP_002873068.1| hypothetical protein ARALYDRAFT_324948 [Arabidopsis lyrata subsp. lyrata] gi|297318905|gb|EFH49327.1| hypothetical protein ARALYDRAFT_324948 [Arabidopsis lyrata subsp. lyrata] Length = 355 Score = 64.3 bits (155), Expect = 1e-08 Identities = 36/87 (41%), Positives = 54/87 (62%), Gaps = 2/87 (2%) Frame = -1 Query: 256 KFPSKLDVEGIQSIVPTKPTDPRQSCKIHVPQDLGSAALLQRRFHLLLGYTKGYD--EDS 83 K P + + G+QS++P + T R+ I V +G + +R +++ Y + D ++ Sbjct: 4 KIPKSM-IAGVQSVMPVEVTRHREIRSISVVDPVG-VGIFRRTLNIVTYYKEACDSGDER 61 Query: 82 GWLVAGLIKESLGRALMEQPLLAGRLR 2 GWL AG IKESLGRAL EQP+L+GRLR Sbjct: 62 GWLAAGWIKESLGRALTEQPMLSGRLR 88 >ref|NP_195909.1| HXXXD-type acyl-transferase-like protein [Arabidopsis thaliana] gi|7413564|emb|CAB86043.1| putative protein [Arabidopsis thaliana] gi|27311867|gb|AAO00899.1| putative protein [Arabidopsis thaliana] gi|34098861|gb|AAQ56813.1| At5g02890 [Arabidopsis thaliana] gi|332003149|gb|AED90532.1| HXXXD-type acyl-transferase-like protein [Arabidopsis thaliana] Length = 353 Score = 63.5 bits (153), Expect = 2e-08 Identities = 35/87 (40%), Positives = 54/87 (62%), Gaps = 2/87 (2%) Frame = -1 Query: 256 KFPSKLDVEGIQSIVPTKPTDPRQSCKIHVPQDLGSAALLQRRFHLLLGYTKGYDE--DS 83 K P + + G+Q+++P + T R+ + V +G + +R +++ Y + D + Sbjct: 4 KIPKSM-IAGVQTVMPVEVTQHREIRSVSVVDPVG-VGIFRRTVNIVTYYKEAGDSGGER 61 Query: 82 GWLVAGLIKESLGRALMEQPLLAGRLR 2 GWLVAG IKESLGRAL EQP+L+GRLR Sbjct: 62 GWLVAGWIKESLGRALTEQPMLSGRLR 88