BLASTX nr result
ID: Scutellaria24_contig00023960
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00023960 (248 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN76078.1| hypothetical protein VITISV_008973 [Vitis vinifera] 38 4e-06 >emb|CAN76078.1| hypothetical protein VITISV_008973 [Vitis vinifera] Length = 1146 Score = 38.1 bits (87), Expect(2) = 4e-06 Identities = 18/38 (47%), Positives = 24/38 (63%) Frame = -2 Query: 178 PSEDQVADILTKALPRSQFYKLCQTYPLRYTSVQLKGG 65 PS+DQ+ADI TK LP +QF L + Y + L+GG Sbjct: 1109 PSDDQLADIFTKHLPITQFCNLRSKLTVTYPPLSLRGG 1146 Score = 37.4 bits (85), Expect(2) = 4e-06 Identities = 13/24 (54%), Positives = 21/24 (87%) Frame = -3 Query: 246 HIEIDIHFIREKVMANQIEVRFVP 175 HIE+D+HFIREKV+ ++++ +VP Sbjct: 1086 HIELDLHFIREKVLRQELQICYVP 1109