BLASTX nr result
ID: Scutellaria24_contig00023946
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00023946 (310 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510746.1| Squamosa promoter-binding protein, putative ... 100 1e-19 ref|XP_002301891.1| predicted protein [Populus trichocarpa] gi|2... 100 2e-19 emb|CBI40788.3| unnamed protein product [Vitis vinifera] 99 5e-19 ref|XP_002273784.1| PREDICTED: squamosa promoter-binding-like pr... 99 5e-19 ref|XP_002307005.1| predicted protein [Populus trichocarpa] gi|2... 98 8e-19 >ref|XP_002510746.1| Squamosa promoter-binding protein, putative [Ricinus communis] gi|223551447|gb|EEF52933.1| Squamosa promoter-binding protein, putative [Ricinus communis] Length = 1073 Score = 100 bits (249), Expect = 1e-19 Identities = 44/50 (88%), Positives = 46/50 (92%) Frame = +2 Query: 161 QPVSRPNKRVRSGSPGGANYPMCQVDNCNEDLSTAKDYHRRHKVCEVHSK 310 +PVSRPNKRVRSGSPG A YPMCQVDNC EDLS AKDYHRRHKVCE+HSK Sbjct: 127 EPVSRPNKRVRSGSPGTATYPMCQVDNCKEDLSNAKDYHRRHKVCELHSK 176 >ref|XP_002301891.1| predicted protein [Populus trichocarpa] gi|222843617|gb|EEE81164.1| predicted protein [Populus trichocarpa] Length = 1044 Score = 99.8 bits (247), Expect = 2e-19 Identities = 43/50 (86%), Positives = 46/50 (92%) Frame = +2 Query: 161 QPVSRPNKRVRSGSPGGANYPMCQVDNCNEDLSTAKDYHRRHKVCEVHSK 310 +PVSRPNKRVRSGSPG +YPMCQVDNC EDLS AKDYHRRHKVC+VHSK Sbjct: 85 EPVSRPNKRVRSGSPGNGSYPMCQVDNCKEDLSKAKDYHRRHKVCQVHSK 134 >emb|CBI40788.3| unnamed protein product [Vitis vinifera] Length = 921 Score = 98.6 bits (244), Expect = 5e-19 Identities = 42/50 (84%), Positives = 47/50 (94%) Frame = +2 Query: 161 QPVSRPNKRVRSGSPGGANYPMCQVDNCNEDLSTAKDYHRRHKVCEVHSK 310 +PVSRP+KRVRSGSPG ++YPMCQVDNC EDLS AKDYHRRHKVCE+HSK Sbjct: 100 EPVSRPSKRVRSGSPGSSSYPMCQVDNCREDLSNAKDYHRRHKVCEMHSK 149 >ref|XP_002273784.1| PREDICTED: squamosa promoter-binding-like protein 14-like [Vitis vinifera] Length = 1070 Score = 98.6 bits (244), Expect = 5e-19 Identities = 42/50 (84%), Positives = 47/50 (94%) Frame = +2 Query: 161 QPVSRPNKRVRSGSPGGANYPMCQVDNCNEDLSTAKDYHRRHKVCEVHSK 310 +PVSRP+KRVRSGSPG ++YPMCQVDNC EDLS AKDYHRRHKVCE+HSK Sbjct: 128 EPVSRPSKRVRSGSPGSSSYPMCQVDNCREDLSNAKDYHRRHKVCEMHSK 177 >ref|XP_002307005.1| predicted protein [Populus trichocarpa] gi|222856454|gb|EEE94001.1| predicted protein [Populus trichocarpa] Length = 603 Score = 97.8 bits (242), Expect = 8e-19 Identities = 42/50 (84%), Positives = 46/50 (92%) Frame = +2 Query: 161 QPVSRPNKRVRSGSPGGANYPMCQVDNCNEDLSTAKDYHRRHKVCEVHSK 310 +PVSRPNKRVRSGSP +YPMCQVDNC E+L+TAKDYHRRHKVCEVHSK Sbjct: 123 EPVSRPNKRVRSGSPANGSYPMCQVDNCKENLTTAKDYHRRHKVCEVHSK 172