BLASTX nr result
ID: Scutellaria24_contig00023879
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00023879 (489 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002308904.1| predicted protein [Populus trichocarpa] gi|2... 73 3e-11 emb|CBI30080.3| unnamed protein product [Vitis vinifera] 72 5e-11 ref|XP_002531502.1| conserved hypothetical protein [Ricinus comm... 71 6e-11 gb|ABD28325.1| hypothetical protein MtrDRAFT_AC147961g12v2 [Medi... 70 2e-10 ref|XP_003554129.1| PREDICTED: uncharacterized protein LOC100809... 65 2e-09 >ref|XP_002308904.1| predicted protein [Populus trichocarpa] gi|222854880|gb|EEE92427.1| predicted protein [Populus trichocarpa] Length = 56 Score = 72.8 bits (177), Expect = 3e-11 Identities = 32/47 (68%), Positives = 38/47 (80%) Frame = +3 Query: 171 AGYPNENNPPSGKKKMKWWPRTKPKGERGFLEGCLFALCCCWLCEVC 311 AGYP + P +GKK +PRTK KGERGF+EGCLFALCCCW+CE+C Sbjct: 13 AGYPVDT-PTTGKK---CFPRTKKKGERGFIEGCLFALCCCWICEMC 55 >emb|CBI30080.3| unnamed protein product [Vitis vinifera] Length = 56 Score = 72.0 bits (175), Expect = 5e-11 Identities = 31/47 (65%), Positives = 36/47 (76%) Frame = +3 Query: 174 GYPNENNPPSGKKKMKWWPRTKPKGERGFLEGCLFALCCCWLCEVCF 314 GYP N PP+GK PR+K KG+RGF+EGCLFALCCCW+CE CF Sbjct: 14 GYPPAN-PPTGKNCC---PRSKSKGDRGFIEGCLFALCCCWICEACF 56 >ref|XP_002531502.1| conserved hypothetical protein [Ricinus communis] gi|223528889|gb|EEF30889.1| conserved hypothetical protein [Ricinus communis] Length = 56 Score = 71.2 bits (173), Expect(2) = 6e-11 Identities = 31/49 (63%), Positives = 33/49 (67%), Gaps = 6/49 (12%) Frame = +3 Query: 186 ENNPPSG------KKKMKWWPRTKPKGERGFLEGCLFALCCCWLCEVCF 314 EN PP G K K P TK KG+RGF+EGCLFALCCCWLCE CF Sbjct: 8 ENQPPPGYPTDTPTAKKKCCPNTKKKGDRGFIEGCLFALCCCWLCEACF 56 Score = 20.8 bits (42), Expect(2) = 6e-11 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +1 Query: 79 ENQASQPPPG 108 E Q +QPPPG Sbjct: 5 EKQENQPPPG 14 >gb|ABD28325.1| hypothetical protein MtrDRAFT_AC147961g12v2 [Medicago truncatula] Length = 57 Score = 70.1 bits (170), Expect = 2e-10 Identities = 29/46 (63%), Positives = 35/46 (76%) Frame = +3 Query: 174 GYPNENNPPSGKKKMKWWPRTKPKGERGFLEGCLFALCCCWLCEVC 311 GYP + +PP+ K K + TK KG+RGF+EGCLFALCCCWLCE C Sbjct: 14 GYPTDQDPPT---KRKLFISTKKKGDRGFIEGCLFALCCCWLCEEC 56 >ref|XP_003554129.1| PREDICTED: uncharacterized protein LOC100809835 [Glycine max] Length = 56 Score = 65.5 bits (158), Expect(2) = 2e-09 Identities = 29/46 (63%), Positives = 32/46 (69%) Frame = +3 Query: 174 GYPNENNPPSGKKKMKWWPRTKPKGERGFLEGCLFALCCCWLCEVC 311 GYP EN P K K + K +GERGF+EGCLFALCCCWLCE C Sbjct: 14 GYPTENPPA----KRKLFFGLKKRGERGFIEGCLFALCCCWLCEEC 55 Score = 21.2 bits (43), Expect(2) = 2e-09 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +1 Query: 79 ENQASQPPPG 108 E Q +QPPPG Sbjct: 5 ETQGNQPPPG 14