BLASTX nr result
ID: Scutellaria24_contig00023778
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00023778 (374 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270776.2| PREDICTED: uncharacterized protein LOC100249... 96 3e-18 emb|CBI26484.3| unnamed protein product [Vitis vinifera] 96 3e-18 ref|XP_004148077.1| PREDICTED: WEB family protein At5g16730, chl... 96 4e-18 ref|XP_002520069.1| ATP binding protein, putative [Ricinus commu... 92 6e-17 ref|XP_003610816.1| Interactor of constitutive active ROPs [Medi... 77 1e-12 >ref|XP_002270776.2| PREDICTED: uncharacterized protein LOC100249386 [Vitis vinifera] Length = 846 Score = 95.9 bits (237), Expect = 3e-18 Identities = 56/99 (56%), Positives = 71/99 (71%), Gaps = 5/99 (5%) Frame = -2 Query: 328 MSAKSKSALPGTPNTK-SPATPRVSR----VTKSSGDSISSLQNARFPVDRSPGSVTSKP 164 M++KSKS L TPN+K SPATPRVS+ V KS DS S L N R VDRSP SV SKP Sbjct: 1 MASKSKSTLSDTPNSKPSPATPRVSKLGRGVAKSETDSPSPLHNPRISVDRSPRSVASKP 60 Query: 163 KVERPSPKVTTPTDRKATRIVKPYLEVQAELNQAQENLK 47 +ER SPKV+TP ++ +R++K E+QA+L+ AQE+LK Sbjct: 61 TIERRSPKVSTPPEKPQSRVLKG-SELQAQLSHAQEDLK 98 >emb|CBI26484.3| unnamed protein product [Vitis vinifera] Length = 825 Score = 95.9 bits (237), Expect = 3e-18 Identities = 56/99 (56%), Positives = 71/99 (71%), Gaps = 5/99 (5%) Frame = -2 Query: 328 MSAKSKSALPGTPNTK-SPATPRVSR----VTKSSGDSISSLQNARFPVDRSPGSVTSKP 164 M++KSKS L TPN+K SPATPRVS+ V KS DS S L N R VDRSP SV SKP Sbjct: 1 MASKSKSTLSDTPNSKPSPATPRVSKLGRGVAKSETDSPSPLHNPRISVDRSPRSVASKP 60 Query: 163 KVERPSPKVTTPTDRKATRIVKPYLEVQAELNQAQENLK 47 +ER SPKV+TP ++ +R++K E+QA+L+ AQE+LK Sbjct: 61 TIERRSPKVSTPPEKPQSRVLKG-SELQAQLSHAQEDLK 98 >ref|XP_004148077.1| PREDICTED: WEB family protein At5g16730, chloroplastic-like [Cucumis sativus] gi|449531197|ref|XP_004172574.1| PREDICTED: WEB family protein At5g16730, chloroplastic-like [Cucumis sativus] Length = 879 Score = 95.5 bits (236), Expect = 4e-18 Identities = 54/98 (55%), Positives = 64/98 (65%), Gaps = 4/98 (4%) Frame = -2 Query: 328 MSAKSKSALPGTPNTKSPATPRVSR----VTKSSGDSISSLQNARFPVDRSPGSVTSKPK 161 MS KSKS+ P TPN SPATPRVS+ + KS DS S LQ +R +DRSP TSKP Sbjct: 1 MSTKSKSSTPETPNKTSPATPRVSKLNRGIAKSESDSHSPLQRSRLSIDRSPRPATSKPA 60 Query: 160 VERPSPKVTTPTDRKATRIVKPYLEVQAELNQAQENLK 47 V+R PKV TP D+ R K E+QA+LN AQE+LK Sbjct: 61 VDRQLPKVATPPDKAQPRSTKG-SEIQAQLNVAQEDLK 97 >ref|XP_002520069.1| ATP binding protein, putative [Ricinus communis] gi|223540833|gb|EEF42393.1| ATP binding protein, putative [Ricinus communis] Length = 841 Score = 91.7 bits (226), Expect = 6e-17 Identities = 52/98 (53%), Positives = 68/98 (69%), Gaps = 4/98 (4%) Frame = -2 Query: 328 MSAKSKSALPGTPNTKSPATPRVSR----VTKSSGDSISSLQNARFPVDRSPGSVTSKPK 161 MS+K+KS L TP+ SPATPRVS+ V KS DS + QN+R V+RSP ++T KP Sbjct: 1 MSSKTKSGLSETPSKASPATPRVSKLSRGVNKSEPDSPAPTQNSRLSVERSPRTITPKPT 60 Query: 160 VERPSPKVTTPTDRKATRIVKPYLEVQAELNQAQENLK 47 V+R SPKVTTP +R R+VK E+QA+L+ QE+LK Sbjct: 61 VDRRSPKVTTPPERPQIRVVKG-SELQAQLSGVQEDLK 97 >ref|XP_003610816.1| Interactor of constitutive active ROPs [Medicago truncatula] gi|355512151|gb|AES93774.1| Interactor of constitutive active ROPs [Medicago truncatula] Length = 887 Score = 77.0 bits (188), Expect = 1e-12 Identities = 44/90 (48%), Positives = 56/90 (62%), Gaps = 5/90 (5%) Frame = -2 Query: 301 PGTPNTKSPATPRVSR----VTKSSGDSISSLQNARFPVDR-SPGSVTSKPKVERPSPKV 137 P TPN SPATPRVS+ V+K +S S LQ +R ++ SP S+ SKP ER SP+ Sbjct: 37 PATPNKTSPATPRVSKLGRGVSKPESESPSPLQTSRLSAEKASPRSLNSKPIAERKSPRP 96 Query: 136 TTPTDRKATRIVKPYLEVQAELNQAQENLK 47 TTP D+ R V E+Q +LN AQE+LK Sbjct: 97 TTPADKHTPRAVAKSSELQTQLNVAQEDLK 126