BLASTX nr result
ID: Scutellaria24_contig00023504
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00023504 (319 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003607325.1| Pentatricopeptide repeat-containing protein ... 66 3e-09 ref|XP_003529932.1| PREDICTED: pentatricopeptide repeat-containi... 62 5e-08 ref|XP_002309609.1| predicted protein [Populus trichocarpa] gi|2... 62 6e-08 ref|XP_004164884.1| PREDICTED: pentatricopeptide repeat-containi... 61 8e-08 ref|XP_004148467.1| PREDICTED: pentatricopeptide repeat-containi... 61 8e-08 >ref|XP_003607325.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355508380|gb|AES89522.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 834 Score = 65.9 bits (159), Expect = 3e-09 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = +1 Query: 4 NFRQGNMQEAFRLHDEMLDRGLAPEDTTHDVLVTAKNK 117 NFR+GN+QEAFRLHDEMLD+GL P+DTT+D+LV K K Sbjct: 789 NFREGNLQEAFRLHDEMLDKGLVPDDTTYDILVNGKLK 826 >ref|XP_003529932.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Glycine max] Length = 827 Score = 62.0 bits (149), Expect = 5e-08 Identities = 25/36 (69%), Positives = 33/36 (91%) Frame = +1 Query: 4 NFRQGNMQEAFRLHDEMLDRGLAPEDTTHDVLVTAK 111 +F++GN+QEAFRLHDEMLD+GL P+DTT+D+LV K Sbjct: 791 HFKEGNLQEAFRLHDEMLDKGLVPDDTTYDILVNGK 826 >ref|XP_002309609.1| predicted protein [Populus trichocarpa] gi|222855585|gb|EEE93132.1| predicted protein [Populus trichocarpa] Length = 841 Score = 61.6 bits (148), Expect = 6e-08 Identities = 25/39 (64%), Positives = 35/39 (89%) Frame = +1 Query: 4 NFRQGNMQEAFRLHDEMLDRGLAPEDTTHDVLVTAKNKE 120 +F++GN+QEAFRLH+EMLD+GL P+DTT+D+LV K K+ Sbjct: 793 HFKEGNLQEAFRLHNEMLDKGLVPDDTTYDILVNGKVKD 831 >ref|XP_004164884.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Cucumis sativus] Length = 657 Score = 61.2 bits (147), Expect = 8e-08 Identities = 26/40 (65%), Positives = 34/40 (85%) Frame = +1 Query: 4 NFRQGNMQEAFRLHDEMLDRGLAPEDTTHDVLVTAKNKED 123 +F++GN+QEAFRLHDEMLDRGL P++ T+D+LV K K D Sbjct: 609 HFKEGNLQEAFRLHDEMLDRGLVPDNITYDILVNGKFKGD 648 >ref|XP_004148467.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Cucumis sativus] Length = 775 Score = 61.2 bits (147), Expect = 8e-08 Identities = 26/40 (65%), Positives = 34/40 (85%) Frame = +1 Query: 4 NFRQGNMQEAFRLHDEMLDRGLAPEDTTHDVLVTAKNKED 123 +F++GN+QEAFRLHDEMLDRGL P++ T+D+LV K K D Sbjct: 727 HFKEGNLQEAFRLHDEMLDRGLVPDNITYDILVNGKFKGD 766