BLASTX nr result
ID: Scutellaria24_contig00023435
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00023435 (369 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517393.1| hypothetical protein RCOM_0852210 [Ricinus c... 59 4e-07 >ref|XP_002517393.1| hypothetical protein RCOM_0852210 [Ricinus communis] gi|223543404|gb|EEF44935.1| hypothetical protein RCOM_0852210 [Ricinus communis] Length = 220 Score = 58.9 bits (141), Expect = 4e-07 Identities = 35/89 (39%), Positives = 42/89 (47%), Gaps = 7/89 (7%) Frame = -1 Query: 312 APAKNPIYVPAYAPINS--PTKAPAYAPHGCVAMCSSYCKPISPKXXXXXXXXXXXAKFK 139 APA +P VP P++ P+ AP HGCV +C CK K AK K Sbjct: 135 APAPSPSKVP---PVHYLVPSMAPLPMEHGCVPLCEKRCKTHPVKRPCMKVCTACCAKCK 191 Query: 138 CVP-----RFGKCSNWDKVTIRGYLVKCP 67 CVP KC NWD V + GY V+CP Sbjct: 192 CVPPGTTGNLNKCKNWDYVMLHGYEVQCP 220