BLASTX nr result
ID: Scutellaria24_contig00023319
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00023319 (233 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515446.1| transferase, putative [Ricinus communis] gi|... 57 2e-06 >ref|XP_002515446.1| transferase, putative [Ricinus communis] gi|223545390|gb|EEF46895.1| transferase, putative [Ricinus communis] Length = 463 Score = 57.0 bits (136), Expect = 2e-06 Identities = 32/60 (53%), Positives = 39/60 (65%), Gaps = 2/60 (3%) Frame = +2 Query: 59 SVSITNSISVYSNVSFVSPKTLILSNLDRQCPNLMYTVFFYKSCD--QEVSFDSVFSQIK 232 +V+IT +SVY + + L LSNLDRQCP LMY VFFYK +SFDSVFS +K Sbjct: 11 TVAITKKVSVYPKILHPH-RILNLSNLDRQCPMLMYLVFFYKPSHVYDNLSFDSVFSSLK 69