BLASTX nr result
ID: Scutellaria24_contig00023259
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00023259 (308 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABR17749.1| unknown [Picea sitchensis] 59 2e-10 ref|XP_002312852.1| predicted protein [Populus trichocarpa] gi|2... 61 3e-10 ref|XP_002328221.1| predicted protein [Populus trichocarpa] gi|2... 61 5e-10 emb|CAA74372.1| geranylgeranyl reductase [Arabidopsis thaliana] 60 9e-10 ref|NP_177587.1| geranylgeranyl diphosphate reductase [Arabidops... 60 9e-10 >gb|ABR17749.1| unknown [Picea sitchensis] Length = 514 Score = 58.9 bits (141), Expect(2) = 2e-10 Identities = 30/47 (63%), Positives = 31/47 (65%) Frame = -3 Query: 225 PHPEAPASGQSPRTGALVGDAAGYVMKCSDEGIYFVAKSGMTCGEAI 85 P PE P + ALVGDAAGYV KCS EGIYF AKSG C EAI Sbjct: 361 PIPEHPRPRRVKDRVALVGDAAGYVTKCSGEGIYFAAKSGRMCAEAI 407 Score = 30.8 bits (68), Expect(2) = 2e-10 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = -2 Query: 304 IKQFQCTIRNRIKHKIEGGR 245 IKQ+Q RNR K KIEGG+ Sbjct: 334 IKQYQLATRNRAKEKIEGGK 353 >ref|XP_002312852.1| predicted protein [Populus trichocarpa] gi|222849260|gb|EEE86807.1| predicted protein [Populus trichocarpa] Length = 454 Score = 61.2 bits (147), Expect(2) = 3e-10 Identities = 31/47 (65%), Positives = 32/47 (68%) Frame = -3 Query: 225 PHPEAPASGQSPRTGALVGDAAGYVMKCSDEGIYFVAKSGMTCGEAI 85 P PE P + ALVGDAAGYV KCS EGIYF AKSG CGEAI Sbjct: 300 PIPEQPRPRRVRGRVALVGDAAGYVTKCSGEGIYFAAKSGRMCGEAI 346 Score = 28.1 bits (61), Expect(2) = 3e-10 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = -2 Query: 307 NIKQFQCTIRNRIKHKIEGGR*SKWKPTP 221 +IK +Q IR R+K KI+GGR K + P Sbjct: 272 DIKVYQRGIRERVKEKIKGGRVIKVEAHP 300 >ref|XP_002328221.1| predicted protein [Populus trichocarpa] gi|224147708|ref|XP_002336528.1| predicted protein [Populus trichocarpa] gi|222835866|gb|EEE74287.1| predicted protein [Populus trichocarpa] gi|222837736|gb|EEE76101.1| predicted protein [Populus trichocarpa] Length = 451 Score = 60.8 bits (146), Expect(2) = 5e-10 Identities = 31/47 (65%), Positives = 32/47 (68%) Frame = -3 Query: 225 PHPEAPASGQSPRTGALVGDAAGYVMKCSDEGIYFVAKSGMTCGEAI 85 P PE P + ALVGDAAGYV KCS EGIYF AKSG CGEAI Sbjct: 297 PIPEHPRPRRVRGRVALVGDAAGYVTKCSGEGIYFAAKSGRMCGEAI 343 Score = 27.7 bits (60), Expect(2) = 5e-10 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = -2 Query: 307 NIKQFQCTIRNRIKHKIEGGR*SKWKPTP 221 NIK +Q IR R++ KI+GG+ K + P Sbjct: 269 NIKVYQRGIRERVREKIKGGKVIKVEAHP 297 >emb|CAA74372.1| geranylgeranyl reductase [Arabidopsis thaliana] Length = 472 Score = 60.5 bits (145), Expect(2) = 9e-10 Identities = 30/47 (63%), Positives = 32/47 (68%) Frame = -3 Query: 225 PHPEAPASGQSPRTGALVGDAAGYVMKCSDEGIYFVAKSGMTCGEAI 85 P PE P + + ALVGDAAGYV KCS EGIYF AKSG C EAI Sbjct: 319 PIPEHPRPRRLSKRVALVGDAAGYVTKCSGEGIYFAAKSGRMCAEAI 365 Score = 27.3 bits (59), Expect(2) = 9e-10 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = -2 Query: 307 NIKQFQCTIRNRIKHKIEGGR 245 +IK+FQ RNR K KI GG+ Sbjct: 291 DIKKFQLATRNRAKDKILGGK 311 >ref|NP_177587.1| geranylgeranyl diphosphate reductase [Arabidopsis thaliana] gi|75333617|sp|Q9CA67.1|CHLP_ARATH RecName: Full=Geranylgeranyl diphosphate reductase, chloroplastic; AltName: Full=Geranylgeranyl reductase; Flags: Precursor gi|12324810|gb|AAG52372.1|AC011765_24 geranylgeranyl reductase; 47568-49165 [Arabidopsis thaliana] gi|15292919|gb|AAK92830.1| putative geranylgeranyl reductase [Arabidopsis thaliana] gi|15450455|gb|AAK96521.1| At1g74470/F1M20_15 [Arabidopsis thaliana] gi|16648981|gb|AAL24342.1| geranylgeranyl reductase [Arabidopsis thaliana] gi|18700167|gb|AAL77695.1| At1g74470/F1M20_15 [Arabidopsis thaliana] gi|20259041|gb|AAM14236.1| putative geranylgeranyl reductase [Arabidopsis thaliana] gi|20857316|gb|AAM26711.1| At1g74470/F1M20_15 [Arabidopsis thaliana] gi|23397186|gb|AAN31876.1| putative geranylgeranyl reductase [Arabidopsis thaliana] gi|27311931|gb|AAO00931.1| geranylgeranyl reductase [Arabidopsis thaliana] gi|332197476|gb|AEE35597.1| geranylgeranyl diphosphate reductase [Arabidopsis thaliana] Length = 467 Score = 60.5 bits (145), Expect(2) = 9e-10 Identities = 30/47 (63%), Positives = 32/47 (68%) Frame = -3 Query: 225 PHPEAPASGQSPRTGALVGDAAGYVMKCSDEGIYFVAKSGMTCGEAI 85 P PE P + + ALVGDAAGYV KCS EGIYF AKSG C EAI Sbjct: 314 PIPEHPRPRRLSKRVALVGDAAGYVTKCSGEGIYFAAKSGRMCAEAI 360 Score = 27.3 bits (59), Expect(2) = 9e-10 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = -2 Query: 307 NIKQFQCTIRNRIKHKIEGGR 245 +IK+FQ RNR K KI GG+ Sbjct: 286 DIKKFQLATRNRAKDKILGGK 306