BLASTX nr result
ID: Scutellaria24_contig00023169
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00023169 (392 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI28417.3| unnamed protein product [Vitis vinifera] 80 2e-13 ref|XP_002272021.1| PREDICTED: uncharacterized protein LOC100249... 80 2e-13 ref|XP_002531688.1| conserved hypothetical protein [Ricinus comm... 70 2e-10 ref|XP_003617946.1| Nucleoporin [Medicago truncatula] gi|3555192... 65 6e-09 emb|CAI64810.1| nucleoporin [Lotus japonicus] gi|83423284|emb|CA... 65 7e-09 >emb|CBI28417.3| unnamed protein product [Vitis vinifera] Length = 1255 Score = 79.7 bits (195), Expect = 2e-13 Identities = 39/51 (76%), Positives = 44/51 (86%) Frame = -1 Query: 392 GRFDEVLPLRFDDSEHPNLKETNSSVETVLMQHKDFPDAGKLMLTAIMHGS 240 G FDEVL LR ++ E PNLKE+ SSVET+LMQHKDFPDAGKLMLTA+M GS Sbjct: 1190 GGFDEVLVLRQENMEIPNLKESGSSVETILMQHKDFPDAGKLMLTAVMMGS 1240 >ref|XP_002272021.1| PREDICTED: uncharacterized protein LOC100249432 isoform 1 [Vitis vinifera] Length = 1330 Score = 79.7 bits (195), Expect = 2e-13 Identities = 39/51 (76%), Positives = 44/51 (86%) Frame = -1 Query: 392 GRFDEVLPLRFDDSEHPNLKETNSSVETVLMQHKDFPDAGKLMLTAIMHGS 240 G FDEVL LR ++ E PNLKE+ SSVET+LMQHKDFPDAGKLMLTA+M GS Sbjct: 1265 GGFDEVLVLRQENMEIPNLKESGSSVETILMQHKDFPDAGKLMLTAVMMGS 1315 >ref|XP_002531688.1| conserved hypothetical protein [Ricinus communis] gi|223528664|gb|EEF30679.1| conserved hypothetical protein [Ricinus communis] Length = 1391 Score = 69.7 bits (169), Expect = 2e-10 Identities = 40/66 (60%), Positives = 46/66 (69%) Frame = -1 Query: 386 FDEVLPLRFDDSEHPNLKETNSSVETVLMQHKDFPDAGKLMLTAIMHGSNWVPSSPRMGM 207 FD+VLPLR ++SE LK + SVE VLMQHKDFPDAGKLMLTAIM GS V ++ Sbjct: 1328 FDKVLPLRKENSEVSALKGLDFSVEAVLMQHKDFPDAGKLMLTAIMLGS--VHDDTKVEE 1385 Query: 206 NYDPME 189 PME Sbjct: 1386 GTSPME 1391 >ref|XP_003617946.1| Nucleoporin [Medicago truncatula] gi|355519281|gb|AET00905.1| Nucleoporin [Medicago truncatula] Length = 1308 Score = 65.1 bits (157), Expect = 6e-09 Identities = 32/49 (65%), Positives = 39/49 (79%) Frame = -1 Query: 386 FDEVLPLRFDDSEHPNLKETNSSVETVLMQHKDFPDAGKLMLTAIMHGS 240 FD+VLPLR ++ E L + +SSVET+LMQHKDFP AGKLML A+M GS Sbjct: 1244 FDQVLPLRQENMETSTLGDMSSSVETILMQHKDFPVAGKLMLMAVMLGS 1292 >emb|CAI64810.1| nucleoporin [Lotus japonicus] gi|83423284|emb|CAI64811.1| nucleoporin [Lotus japonicus] Length = 1309 Score = 64.7 bits (156), Expect = 7e-09 Identities = 32/50 (64%), Positives = 40/50 (80%) Frame = -1 Query: 386 FDEVLPLRFDDSEHPNLKETNSSVETVLMQHKDFPDAGKLMLTAIMHGSN 237 FD+VLPLR ++ E L + +SSVET+LMQHKDFP AGKLML A+M GS+ Sbjct: 1245 FDQVLPLRQENMETSMLGDMSSSVETILMQHKDFPVAGKLMLMAVMLGSD 1294