BLASTX nr result
ID: Scutellaria24_contig00022676
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00022676 (291 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516502.1| Transcriptional factor TINY, putative [Ricin... 55 8e-06 >ref|XP_002516502.1| Transcriptional factor TINY, putative [Ricinus communis] gi|223544322|gb|EEF45843.1| Transcriptional factor TINY, putative [Ricinus communis] Length = 270 Score = 54.7 bits (130), Expect = 8e-06 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 7/50 (14%) Frame = -3 Query: 289 EELSEIVELPSLGSCFDSVELRTDFVYMDN-DVWLDHLPPW------GGG 161 EELSEIVELPSLG+ ++S ELR+DFVY+D+ D W+ + PPW GGG Sbjct: 188 EELSEIVELPSLGTSYESSELRSDFVYVDSVDGWV-YPPPWLEESHVGGG 236