BLASTX nr result
ID: Scutellaria24_contig00022671
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00022671 (208 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEW43293.1| hypothetical protein [Hevea brasiliensis] 90 2e-16 ref|XP_002302617.1| predicted protein [Populus trichocarpa] gi|2... 87 1e-15 ref|XP_002532659.1| conserved hypothetical protein [Ricinus comm... 86 3e-15 ref|XP_002320849.1| predicted protein [Populus trichocarpa] gi|2... 86 3e-15 ref|XP_002280531.1| PREDICTED: uncharacterized protein LOC100261... 85 5e-15 >gb|AEW43293.1| hypothetical protein [Hevea brasiliensis] Length = 79 Score = 90.1 bits (222), Expect = 2e-16 Identities = 41/56 (73%), Positives = 45/56 (80%), Gaps = 1/56 (1%) Frame = -3 Query: 167 ATDRC-VFQMPLHYPKYTRAEYELMSEWKLDCLLTEYGLHVCGDVNYKRNFAMGAF 3 A DRC FQMPLHYP+YT AEY+ M EWKLDCLL EYGL + G+V YKR FAMGAF Sbjct: 20 AKDRCGYFQMPLHYPRYTHAEYDTMPEWKLDCLLKEYGLPITGNVEYKRKFAMGAF 75 >ref|XP_002302617.1| predicted protein [Populus trichocarpa] gi|222844343|gb|EEE81890.1| predicted protein [Populus trichocarpa] Length = 79 Score = 87.0 bits (214), Expect = 1e-15 Identities = 40/54 (74%), Positives = 44/54 (81%), Gaps = 1/54 (1%) Frame = -3 Query: 161 DRCV-FQMPLHYPKYTRAEYELMSEWKLDCLLTEYGLHVCGDVNYKRNFAMGAF 3 +RC FQMPLHYP+YT AEY+ M EWKLDCLL EYGL + GDV KRNFAMGAF Sbjct: 22 ERCGDFQMPLHYPRYTLAEYQTMPEWKLDCLLKEYGLPITGDVEQKRNFAMGAF 75 >ref|XP_002532659.1| conserved hypothetical protein [Ricinus communis] gi|223527619|gb|EEF29732.1| conserved hypothetical protein [Ricinus communis] Length = 79 Score = 85.9 bits (211), Expect = 3e-15 Identities = 39/56 (69%), Positives = 44/56 (78%), Gaps = 1/56 (1%) Frame = -3 Query: 167 ATDRC-VFQMPLHYPKYTRAEYELMSEWKLDCLLTEYGLHVCGDVNYKRNFAMGAF 3 A D C FQMP+HYP+YTRAEYE M EW+LDCLL YGL + GDV+YKR FAMG F Sbjct: 20 AKDLCGYFQMPVHYPRYTRAEYESMPEWQLDCLLKAYGLPITGDVDYKRKFAMGTF 75 >ref|XP_002320849.1| predicted protein [Populus trichocarpa] gi|222861622|gb|EEE99164.1| predicted protein [Populus trichocarpa] Length = 79 Score = 85.9 bits (211), Expect = 3e-15 Identities = 39/54 (72%), Positives = 44/54 (81%), Gaps = 1/54 (1%) Frame = -3 Query: 161 DRC-VFQMPLHYPKYTRAEYELMSEWKLDCLLTEYGLHVCGDVNYKRNFAMGAF 3 +RC FQMPLHYP++TRAEYE M EWKLDCLL EYGL + GDV KR +AMGAF Sbjct: 22 ERCGSFQMPLHYPRHTRAEYETMPEWKLDCLLREYGLPITGDVEQKRKYAMGAF 75 >ref|XP_002280531.1| PREDICTED: uncharacterized protein LOC100261908 [Vitis vinifera] gi|297745397|emb|CBI40477.3| unnamed protein product [Vitis vinifera] Length = 80 Score = 85.1 bits (209), Expect = 5e-15 Identities = 39/54 (72%), Positives = 43/54 (79%), Gaps = 1/54 (1%) Frame = -3 Query: 161 DRC-VFQMPLHYPKYTRAEYELMSEWKLDCLLTEYGLHVCGDVNYKRNFAMGAF 3 DRC FQMPLHYP+YT+A+YE M EWK+DCLL EYGL V G V KR FAMGAF Sbjct: 23 DRCGQFQMPLHYPRYTQADYETMPEWKIDCLLAEYGLPVTGGVEQKRKFAMGAF 76