BLASTX nr result
ID: Scutellaria24_contig00022642
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00022642 (291 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAC28522.1| Contains similarity to ANK repeat region of Fowlp... 55 6e-06 >gb|AAC28522.1| Contains similarity to ANK repeat region of Fowlpox virus BamHI-orf7 protein homolog C18F10.7 gi|485107 from Caenorhabditis elegans cosmid gb|U00049. This gene is continued from unannotated gene on BAC F19K23 gb|AC000375 [Arabidopsis thaliana] Length = 684 Score = 55.1 bits (131), Expect = 6e-06 Identities = 25/39 (64%), Positives = 30/39 (76%), Gaps = 1/39 (2%) Frame = +1 Query: 85 FSTRQTGMASDGPSWADQWGEGGIGAIPDE-STKSNKDA 198 F+ R MAS+ PSWADQWG GGIG +P+E +TKS KDA Sbjct: 611 FAKRYRNMASEAPSWADQWGTGGIGEMPEEDNTKSKKDA 649