BLASTX nr result
ID: Scutellaria24_contig00022240
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00022240 (258 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527480.1| conserved hypothetical protein [Ricinus comm... 59 4e-07 >ref|XP_002527480.1| conserved hypothetical protein [Ricinus communis] gi|223533120|gb|EEF34878.1| conserved hypothetical protein [Ricinus communis] Length = 379 Score = 58.9 bits (141), Expect = 4e-07 Identities = 29/84 (34%), Positives = 53/84 (63%), Gaps = 1/84 (1%) Frame = -3 Query: 253 NHALLRRYDKYDKQEHYSL-CKKNGLFGINSSSDLEFPFKSRIGYFRIVGSCDGLVCLSD 77 N+ +LR Y + +K+E ++L + +F + +L+FP +S YF IVGSC+G++CL+D Sbjct: 56 NYLILRHYSRSNKKERFALHFDDDDMF--SEYQELDFPLESSWDYFEIVGSCNGIICLTD 113 Query: 76 DFFVNPSQPVIIWNPCVRSHVVLP 5 + + + +++WNP + V LP Sbjct: 114 N-HSHILKRIVLWNPSIGLSVTLP 136