BLASTX nr result
ID: Scutellaria24_contig00022183
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00022183 (320 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278362.1| PREDICTED: uncharacterized protein At5g39865... 121 5e-26 ref|XP_002276361.1| PREDICTED: uncharacterized protein At5g39865... 118 4e-25 emb|CAN73338.1| hypothetical protein VITISV_042400 [Vitis vinifera] 118 4e-25 ref|XP_004143166.1| PREDICTED: uncharacterized protein At5g39865... 112 3e-23 ref|XP_003538314.1| PREDICTED: uncharacterized protein At5g39865... 112 4e-23 >ref|XP_002278362.1| PREDICTED: uncharacterized protein At5g39865 [Vitis vinifera] gi|297745854|emb|CBI15910.3| unnamed protein product [Vitis vinifera] Length = 246 Score = 121 bits (304), Expect = 5e-26 Identities = 62/87 (71%), Positives = 73/87 (83%) Frame = -2 Query: 262 IRIRGAEKLVVVYFTSLRVIRRTFDDCSAVRSILRAFRVPIDERDLAMDSMFMDELQRIL 83 I I GAE +VVYFTSLRV+R TF+DC VRSILR FRV +DERDLAMDS F++ELQ IL Sbjct: 88 ISIPGAESRIVVYFTSLRVVRSTFEDCRVVRSILRGFRVSMDERDLAMDSGFLEELQGIL 147 Query: 82 GVSEKSQLTLPRVFIGGRYIGGAEEVK 2 G +++LTLPRVFIGGRYIGGAEE++ Sbjct: 148 G---QTKLTLPRVFIGGRYIGGAEEIR 171 >ref|XP_002276361.1| PREDICTED: uncharacterized protein At5g39865 [Vitis vinifera] Length = 239 Score = 118 bits (296), Expect = 4e-25 Identities = 56/87 (64%), Positives = 74/87 (85%) Frame = -2 Query: 262 IRIRGAEKLVVVYFTSLRVIRRTFDDCSAVRSILRAFRVPIDERDLAMDSMFMDELQRIL 83 + + G ++ VVVYFTSLRV+R+TF+DCS VRSILR FRV +DERDL+MD+ F+DEL+ IL Sbjct: 85 VSLTGGDQSVVVYFTSLRVVRKTFEDCSTVRSILRGFRVKVDERDLSMDAGFLDELKGIL 144 Query: 82 GVSEKSQLTLPRVFIGGRYIGGAEEVK 2 G + +L+LPRVFIGGRY+GGAEE++ Sbjct: 145 G---RKKLSLPRVFIGGRYVGGAEEIR 168 >emb|CAN73338.1| hypothetical protein VITISV_042400 [Vitis vinifera] Length = 300 Score = 118 bits (296), Expect = 4e-25 Identities = 56/87 (64%), Positives = 74/87 (85%) Frame = -2 Query: 262 IRIRGAEKLVVVYFTSLRVIRRTFDDCSAVRSILRAFRVPIDERDLAMDSMFMDELQRIL 83 + + G ++ VVVYFTSLRV+R+TF+DCS VRSILR FRV +DERDL+MD+ F+DEL+ IL Sbjct: 85 VSLTGGDQSVVVYFTSLRVVRKTFEDCSTVRSILRGFRVKVDERDLSMDAGFLDELKGIL 144 Query: 82 GVSEKSQLTLPRVFIGGRYIGGAEEVK 2 G + +L+LPRVFIGGRY+GGAEE++ Sbjct: 145 G---RKKLSLPRVFIGGRYVGGAEEIR 168 >ref|XP_004143166.1| PREDICTED: uncharacterized protein At5g39865-like [Cucumis sativus] gi|449519324|ref|XP_004166685.1| PREDICTED: uncharacterized protein At5g39865-like [Cucumis sativus] Length = 259 Score = 112 bits (280), Expect = 3e-23 Identities = 59/105 (56%), Positives = 75/105 (71%) Frame = -2 Query: 316 LSYREPRNEDVSDESGQEIRIRGAEKLVVVYFTSLRVIRRTFDDCSAVRSILRAFRVPID 137 L + +P++ S + ++K +VVYFTSLRV+R TF+DC VRSILR FRV ID Sbjct: 85 LKFLDPKSTKSSQVPSRSEAGPVSDKRIVVYFTSLRVVRSTFEDCKTVRSILRGFRVSID 144 Query: 136 ERDLAMDSMFMDELQRILGVSEKSQLTLPRVFIGGRYIGGAEEVK 2 ERDL+MDS F+ ELQ+ILG K +L LP VFIGG YIGGAEE++ Sbjct: 145 ERDLSMDSGFVAELQQILG---KKELPLPTVFIGGEYIGGAEEIR 186 >ref|XP_003538314.1| PREDICTED: uncharacterized protein At5g39865-like [Glycine max] Length = 231 Score = 112 bits (279), Expect = 4e-23 Identities = 55/82 (67%), Positives = 68/82 (82%) Frame = -2 Query: 247 AEKLVVVYFTSLRVIRRTFDDCSAVRSILRAFRVPIDERDLAMDSMFMDELQRILGVSEK 68 +E+ VVVYFTSLRV+R TF+DC VRSILR FRV +DERD++MDS F+ EL+R+ G K Sbjct: 81 SEQRVVVYFTSLRVVRATFEDCKTVRSILRGFRVALDERDVSMDSGFLSELRRVTG--HK 138 Query: 67 SQLTLPRVFIGGRYIGGAEEVK 2 S LTLPRVFI GRY+GGAEE++ Sbjct: 139 SGLTLPRVFINGRYVGGAEELR 160