BLASTX nr result
ID: Scutellaria24_contig00022064
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00022064 (969 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI34150.3| unnamed protein product [Vitis vinifera] 76 1e-11 ref|XP_002263190.1| PREDICTED: coproporphyrinogen-III oxidase, c... 76 1e-11 ref|XP_002518396.1| coproporphyrinogen III oxidase, putative [Ri... 76 1e-11 emb|CAN76809.1| hypothetical protein VITISV_044041 [Vitis vinifera] 76 1e-11 sp|P35055.1|HEM6_SOYBN RecName: Full=Coproporphyrinogen-III oxid... 74 4e-11 >emb|CBI34150.3| unnamed protein product [Vitis vinifera] Length = 307 Score = 76.3 bits (186), Expect = 1e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 872 DTPGAPRQWWFGGGTDLTPAYIFEEDVKHFH 964 DTPGAPRQWWFGGGTDLTPAYIFEEDVKHFH Sbjct: 122 DTPGAPRQWWFGGGTDLTPAYIFEEDVKHFH 152 >ref|XP_002263190.1| PREDICTED: coproporphyrinogen-III oxidase, chloroplastic-like [Vitis vinifera] Length = 401 Score = 76.3 bits (186), Expect = 1e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 872 DTPGAPRQWWFGGGTDLTPAYIFEEDVKHFH 964 DTPGAPRQWWFGGGTDLTPAYIFEEDVKHFH Sbjct: 216 DTPGAPRQWWFGGGTDLTPAYIFEEDVKHFH 246 >ref|XP_002518396.1| coproporphyrinogen III oxidase, putative [Ricinus communis] gi|223542241|gb|EEF43783.1| coproporphyrinogen III oxidase, putative [Ricinus communis] Length = 393 Score = 76.3 bits (186), Expect = 1e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 872 DTPGAPRQWWFGGGTDLTPAYIFEEDVKHFH 964 DTPGAPRQWWFGGGTDLTPAYIFEEDVKHFH Sbjct: 208 DTPGAPRQWWFGGGTDLTPAYIFEEDVKHFH 238 >emb|CAN76809.1| hypothetical protein VITISV_044041 [Vitis vinifera] Length = 345 Score = 76.3 bits (186), Expect = 1e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 872 DTPGAPRQWWFGGGTDLTPAYIFEEDVKHFH 964 DTPGAPRQWWFGGGTDLTPAYIFEEDVKHFH Sbjct: 160 DTPGAPRQWWFGGGTDLTPAYIFEEDVKHFH 190 >sp|P35055.1|HEM6_SOYBN RecName: Full=Coproporphyrinogen-III oxidase, chloroplastic; Short=Coprogen oxidase; Short=Coproporphyrinogenase; Flags: Precursor gi|414666|emb|CAA50400.1| coproporphyrinogen oxidase [Glycine max] gi|414667|emb|CAA50401.1| coproporphyrinogen oxidase [Glycine max] Length = 385 Score = 74.3 bits (181), Expect = 4e-11 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +2 Query: 872 DTPGAPRQWWFGGGTDLTPAYIFEEDVKHFH 964 D PGAPRQWWFGGGTDLTPAYIFEEDVKHFH Sbjct: 200 DAPGAPRQWWFGGGTDLTPAYIFEEDVKHFH 230