BLASTX nr result
ID: Scutellaria24_contig00021907
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00021907 (413 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_07270217.1| LOW QUALITY PROTEIN: conserved hypothetical p... 79 5e-13 ref|ZP_06708708.1| LOW QUALITY PROTEIN: hypothetical protein SST... 79 5e-13 ref|ZP_07287470.1| conserved hypothetical protein [Streptomyces ... 77 1e-12 ref|ZP_06577424.1| leucine rich protein [Streptomyces ghanaensis... 75 5e-12 ref|ZP_06578656.1| leucine rich protein [Streptomyces ghanaensis... 74 2e-11 >ref|ZP_07270217.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces sp. SPB78] gi|302426770|gb|EFK98585.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces sp. SPB78] Length = 103 Score = 78.6 bits (192), Expect = 5e-13 Identities = 41/54 (75%), Positives = 43/54 (79%) Frame = -1 Query: 164 AGTRISTGYPSTTPVGLALGPDSPRADKLDPGTLG*SADGIPTRHTLLMPAFSL 3 AGT ISTGYPSTTPVGLALGPD P AD+LDPGTL SA T +LLMPAFSL Sbjct: 1 AGTGISTGYPSTTPVGLALGPDLPWADQLDPGTLSQSAHTFLTCESLLMPAFSL 54 >ref|ZP_06708708.1| LOW QUALITY PROTEIN: hypothetical protein SSTG_02149 [Streptomyces sp. e14] gi|292833481|gb|EFF91830.1| LOW QUALITY PROTEIN: hypothetical protein SSTG_02149 [Streptomyces sp. e14] Length = 106 Score = 78.6 bits (192), Expect = 5e-13 Identities = 41/54 (75%), Positives = 43/54 (79%) Frame = -1 Query: 164 AGTRISTGYPSTTPVGLALGPDSPRADKLDPGTLG*SADGIPTRHTLLMPAFSL 3 AGT ISTGYPSTTPVGLALGPD P AD+LDPGTL SA T +LLMPAFSL Sbjct: 4 AGTGISTGYPSTTPVGLALGPDLPWADQLDPGTLSQSAHTFLTCESLLMPAFSL 57 >ref|ZP_07287470.1| conserved hypothetical protein [Streptomyces sp. C] gi|302535772|ref|ZP_07288114.1| conserved hypothetical protein [Streptomyces sp. C] gi|302444023|gb|EFL15839.1| conserved hypothetical protein [Streptomyces sp. C] gi|302444667|gb|EFL16483.1| conserved hypothetical protein [Streptomyces sp. C] Length = 179 Score = 77.0 bits (188), Expect = 1e-12 Identities = 42/58 (72%), Positives = 45/58 (77%) Frame = -1 Query: 176 GR*QAGTRISTGYPSTTPVGLALGPDSPRADKLDPGTLG*SADGIPTRHTLLMPAFSL 3 GR +AGT ISTG PSTTPVGLALGPD P AD+LDPGTL SA T +LLMPAFSL Sbjct: 39 GRFKAGTGISTGCPSTTPVGLALGPDLPWADQLDPGTLSQSAHTFLTCVSLLMPAFSL 96 >ref|ZP_06577424.1| leucine rich protein [Streptomyces ghanaensis ATCC 14672] gi|291438707|ref|ZP_06578097.1| leucine rich protein [Streptomyces ghanaensis ATCC 14672] gi|291440884|ref|ZP_06580274.1| leucine rich protein [Streptomyces ghanaensis ATCC 14672] gi|291340929|gb|EFE67885.1| leucine rich protein [Streptomyces ghanaensis ATCC 14672] gi|291341602|gb|EFE68558.1| leucine rich protein [Streptomyces ghanaensis ATCC 14672] gi|291343779|gb|EFE70735.1| leucine rich protein [Streptomyces ghanaensis ATCC 14672] Length = 93 Score = 75.1 bits (183), Expect = 5e-12 Identities = 40/54 (74%), Positives = 42/54 (77%) Frame = -1 Query: 164 AGTRISTGYPSTTPVGLALGPDSPRADKLDPGTLG*SADGIPTRHTLLMPAFSL 3 AGT ISTG PSTTPVGLALGPD P AD+LDPGTL SA T +LLMPAFSL Sbjct: 9 AGTGISTGCPSTTPVGLALGPDLPWADQLDPGTLSQSAHTFLTCESLLMPAFSL 62 >ref|ZP_06578656.1| leucine rich protein [Streptomyces ghanaensis ATCC 14672] gi|291342161|gb|EFE69117.1| leucine rich protein [Streptomyces ghanaensis ATCC 14672] Length = 93 Score = 73.6 bits (179), Expect = 2e-11 Identities = 39/54 (72%), Positives = 41/54 (75%) Frame = -1 Query: 164 AGTRISTGYPSTTPVGLALGPDSPRADKLDPGTLG*SADGIPTRHTLLMPAFSL 3 AGT ISTG PSTTPVGLALGPD P AD+LDPGTL S T +LLMPAFSL Sbjct: 9 AGTGISTGCPSTTPVGLALGPDLPWADQLDPGTLSQSTHTFLTCESLLMPAFSL 62