BLASTX nr result
ID: Scutellaria24_contig00021851
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00021851 (273 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002330857.1| predicted protein [Populus trichocarpa] gi|2... 73 3e-11 dbj|BAF80452.1| DC1 domain containing protein [Nicotiana tabacum] 71 1e-10 ref|XP_002268034.2| PREDICTED: uncharacterized protein LOC100244... 65 7e-09 ref|XP_002512181.1| protein binding protein, putative [Ricinus c... 65 7e-09 ref|XP_004151553.1| PREDICTED: probable nucleoredoxin 1-1-like [... 64 1e-08 >ref|XP_002330857.1| predicted protein [Populus trichocarpa] gi|222872679|gb|EEF09810.1| predicted protein [Populus trichocarpa] Length = 190 Score = 72.8 bits (177), Expect = 3e-11 Identities = 27/57 (47%), Positives = 43/57 (75%) Frame = -2 Query: 173 MKHFIHRHPLKQVEIQQKNGTVCSACEWEISGSAYYCTQPHCSFKIDKACFDSPREI 3 +KHF H HPL+ V+++++ ++CS CE ++SGSAY CT+ C F + K+CF+ PRE+ Sbjct: 17 VKHFSHSHPLRPVDVKEEEESICSGCELDLSGSAYKCTKSTCDFFLHKSCFELPREL 73 >dbj|BAF80452.1| DC1 domain containing protein [Nicotiana tabacum] Length = 236 Score = 70.9 bits (172), Expect = 1e-10 Identities = 28/57 (49%), Positives = 41/57 (71%) Frame = -2 Query: 173 MKHFIHRHPLKQVEIQQKNGTVCSACEWEISGSAYYCTQPHCSFKIDKACFDSPREI 3 MKHF H H L+ E+Q+ N +CS CE ++SG +Y CT+P+C F + K+CF+ PR+I Sbjct: 1 MKHFSHPHALELSEVQETNEIICSGCENKLSGISYKCTKPNCKFTLHKSCFELPRKI 57 >ref|XP_002268034.2| PREDICTED: uncharacterized protein LOC100244183 [Vitis vinifera] Length = 309 Score = 64.7 bits (156), Expect = 7e-09 Identities = 25/52 (48%), Positives = 37/52 (71%) Frame = -2 Query: 176 IMKHFIHRHPLKQVEIQQKNGTVCSACEWEISGSAYYCTQPHCSFKIDKACF 21 ++KHF H+HPL E+++++G VCS CE +SGSAY CT +C F + +CF Sbjct: 3 VVKHFSHKHPLCHAEVKEEDGFVCSGCELGLSGSAYKCTISNCDFLLHDSCF 54 >ref|XP_002512181.1| protein binding protein, putative [Ricinus communis] gi|223548725|gb|EEF50215.1| protein binding protein, putative [Ricinus communis] Length = 187 Score = 64.7 bits (156), Expect = 7e-09 Identities = 23/57 (40%), Positives = 39/57 (68%) Frame = -2 Query: 173 MKHFIHRHPLKQVEIQQKNGTVCSACEWEISGSAYYCTQPHCSFKIDKACFDSPREI 3 +KHF H HPL+ ++++ +C CE ++SGSAY C++ C F + K+CF+ P+E+ Sbjct: 16 VKHFSHSHPLRPADVKEDEEIICFGCELDLSGSAYKCSKSKCVFLLHKSCFELPKEL 72 >ref|XP_004151553.1| PREDICTED: probable nucleoredoxin 1-1-like [Cucumis sativus] gi|449524190|ref|XP_004169106.1| PREDICTED: probable nucleoredoxin 1-1-like [Cucumis sativus] Length = 179 Score = 63.9 bits (154), Expect = 1e-08 Identities = 25/58 (43%), Positives = 38/58 (65%) Frame = -2 Query: 176 IMKHFIHRHPLKQVEIQQKNGTVCSACEWEISGSAYYCTQPHCSFKIDKACFDSPREI 3 + +HF H HPL + + +GT+CSACE+ +SG+A+ C++P C F + CF P EI Sbjct: 2 LKQHFSHPHPLAAATLVEDDGTLCSACEFPLSGAAFKCSKPKCEFHLHDLCFALPPEI 59