BLASTX nr result
ID: Scutellaria24_contig00021844
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00021844 (405 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004167400.1| PREDICTED: uncharacterized protein LOC101226... 60 1e-07 >ref|XP_004167400.1| PREDICTED: uncharacterized protein LOC101226019, partial [Cucumis sativus] Length = 504 Score = 60.5 bits (145), Expect = 1e-07 Identities = 28/65 (43%), Positives = 44/65 (67%), Gaps = 1/65 (1%) Frame = -1 Query: 210 FVNSCSGKLLNLKETVVSCQLFHQLLLRQTKTNNQR-VWFDFKGKLARFGLEEFTLVTDL 34 F SC G L+LK + S QLF+ L+ RQ + N+ +WF+ +G++ +FG+++F L+T L Sbjct: 198 FKKSCFGNFLDLKISKFSSQLFYHLIRRQCCSKNRNELWFNLEGRIHKFGMKDFALITGL 257 Query: 33 NAGEL 19 N GEL Sbjct: 258 NCGEL 262