BLASTX nr result
ID: Scutellaria24_contig00021502
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00021502 (352 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAD39207.1| maturase [Pennantia corymbosa] 85 5e-15 emb|CAD39206.1| maturase [Pennantia cunninghamii] 84 2e-14 gb|ACG59016.1| maturase K [Agalinis oligophylla] 84 2e-14 emb|CCJ65332.1| maturase K, partial (chloroplast) [Sternbergia l... 72 6e-11 ref|YP_003359340.2| maturase (chloroplast) [Olea europaea] gi|36... 69 3e-10 >emb|CAD39207.1| maturase [Pennantia corymbosa] Length = 527 Score = 85.1 bits (209), Expect = 5e-15 Identities = 42/55 (76%), Positives = 47/55 (85%), Gaps = 2/55 (3%) Frame = -3 Query: 161 SHYVSFDNPSNLLPLIQIEFQME--QRYLQLERSQQQDFLYPLIFQEYIYAFAHN 3 SHYVSFDN N LPLIQ++FQME QRYL+L+RSQQ FLYPLIFQEYIYA AH+ Sbjct: 1 SHYVSFDNSPNPLPLIQLKFQMEEFQRYLELDRSQQHYFLYPLIFQEYIYALAHD 55 >emb|CAD39206.1| maturase [Pennantia cunninghamii] Length = 527 Score = 83.6 bits (205), Expect = 2e-14 Identities = 41/55 (74%), Positives = 47/55 (85%), Gaps = 2/55 (3%) Frame = -3 Query: 161 SHYVSFDNPSNLLPLIQIEFQME--QRYLQLERSQQQDFLYPLIFQEYIYAFAHN 3 SHYVSFDN N LPLIQ++F+ME QRYL+L+RSQQ FLYPLIFQEYIYA AH+ Sbjct: 1 SHYVSFDNSPNPLPLIQLKFKMEEFQRYLELDRSQQHYFLYPLIFQEYIYALAHD 55 >gb|ACG59016.1| maturase K [Agalinis oligophylla] Length = 263 Score = 83.6 bits (205), Expect = 2e-14 Identities = 43/53 (81%), Positives = 44/53 (83%), Gaps = 2/53 (3%) Frame = -3 Query: 155 YVSFDNPSNLLPLIQIEFQME--QRYLQLERSQQQDFLYPLIFQEYIYAFAHN 3 YVSFDN NLL LIQI FQME Q YLQLERSQQ DFLYPLIFQEYIY FAH+ Sbjct: 1 YVSFDNHPNLLLLIQINFQMEEIQSYLQLERSQQHDFLYPLIFQEYIYTFAHD 53 >emb|CCJ65332.1| maturase K, partial (chloroplast) [Sternbergia lutea] Length = 288 Score = 71.6 bits (174), Expect = 6e-11 Identities = 36/66 (54%), Positives = 48/66 (72%), Gaps = 4/66 (6%) Frame = -3 Query: 191 FLLEYLVLTVSHYVSFDNP--SNLLPLIQIEFQMEQR--YLQLERSQQQDFLYPLIFQEY 24 + +EYLVLT+SHYVSF N S + L+QIE +ME+ YL L R +Q + LYPL+F+EY Sbjct: 80 YCIEYLVLTISHYVSFSNKRGSLIFSLVQIELKMEELKVYLNLTRCRQDNLLYPLLFREY 139 Query: 23 IYAFAH 6 IYA +H Sbjct: 140 IYALSH 145 >ref|YP_003359340.2| maturase (chloroplast) [Olea europaea] gi|363413078|gb|ADA69907.2| maturase (chloroplast) [Olea europaea] Length = 525 Score = 69.3 bits (168), Expect = 3e-10 Identities = 34/44 (77%), Positives = 38/44 (86%), Gaps = 2/44 (4%) Frame = -3 Query: 128 LLPLIQIEFQME--QRYLQLERSQQQDFLYPLIFQEYIYAFAHN 3 LL L+QI+FQME QRYLQL+RSQQ DFLYPLIFQEYIY AH+ Sbjct: 10 LLTLVQIKFQMEEIQRYLQLDRSQQHDFLYPLIFQEYIYGLAHD 53