BLASTX nr result
ID: Scutellaria24_contig00021432
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00021432 (210 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_974469.1| uncharacterized protein [Arabidopsis thaliana] ... 66 3e-09 ref|NP_191640.1| uncharacterized protein [Arabidopsis thaliana] ... 66 3e-09 ref|XP_002876583.1| hypothetical protein ARALYDRAFT_486553 [Arab... 66 3e-09 dbj|BAH57165.1| AT3G60810 [Arabidopsis thaliana] 66 3e-09 emb|CBI38854.3| unnamed protein product [Vitis vinifera] 65 4e-09 >ref|NP_974469.1| uncharacterized protein [Arabidopsis thaliana] gi|332646590|gb|AEE80111.1| uncharacterized protein [Arabidopsis thaliana] Length = 209 Score = 66.2 bits (160), Expect = 3e-09 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -1 Query: 210 RSASRLGNFDFDINRKRIKALRVALEKKGWASENSF 103 RSASR GNFDFD+NRKRIKALR LEKKGW SENSF Sbjct: 174 RSASRKGNFDFDVNRKRIKALRQELEKKGWVSENSF 209 >ref|NP_191640.1| uncharacterized protein [Arabidopsis thaliana] gi|7329691|emb|CAB82685.1| putative protein [Arabidopsis thaliana] gi|110741004|dbj|BAE98596.1| hypothetical protein [Arabidopsis thaliana] gi|117168213|gb|ABK32189.1| At3g60810 [Arabidopsis thaliana] gi|332646589|gb|AEE80110.1| uncharacterized protein [Arabidopsis thaliana] Length = 214 Score = 66.2 bits (160), Expect = 3e-09 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -1 Query: 210 RSASRLGNFDFDINRKRIKALRVALEKKGWASENSF 103 RSASR GNFDFD+NRKRIKALR LEKKGW SENSF Sbjct: 179 RSASRKGNFDFDVNRKRIKALRQELEKKGWVSENSF 214 >ref|XP_002876583.1| hypothetical protein ARALYDRAFT_486553 [Arabidopsis lyrata subsp. lyrata] gi|297322421|gb|EFH52842.1| hypothetical protein ARALYDRAFT_486553 [Arabidopsis lyrata subsp. lyrata] Length = 216 Score = 66.2 bits (160), Expect = 3e-09 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -1 Query: 210 RSASRLGNFDFDINRKRIKALRVALEKKGWASENSF 103 RSASR GNFDFD+NRKRIKALR LEKKGW SENSF Sbjct: 181 RSASRKGNFDFDVNRKRIKALRQELEKKGWVSENSF 216 >dbj|BAH57165.1| AT3G60810 [Arabidopsis thaliana] Length = 93 Score = 66.2 bits (160), Expect = 3e-09 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -1 Query: 210 RSASRLGNFDFDINRKRIKALRVALEKKGWASENSF 103 RSASR GNFDFD+NRKRIKALR LEKKGW SENSF Sbjct: 58 RSASRKGNFDFDVNRKRIKALRQELEKKGWVSENSF 93 >emb|CBI38854.3| unnamed protein product [Vitis vinifera] Length = 321 Score = 65.5 bits (158), Expect = 4e-09 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = -1 Query: 210 RSASRLGNFDFDINRKRIKALRVALEKKGWASENS 106 RSASRLGNFDF++NRKRIKALR+ LEKKGWASE+S Sbjct: 286 RSASRLGNFDFEVNRKRIKALRLELEKKGWASEDS 320