BLASTX nr result
ID: Scutellaria24_contig00021340
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00021340 (734 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515994.1| Cytochrome c oxidase assembly protein COX19,... 143 3e-32 gb|ACG38035.1| cytochrome c oxidase assembly protein COX19 [Zea ... 139 5e-31 ref|XP_002468590.1| hypothetical protein SORBIDRAFT_01g048650 [S... 139 6e-31 gb|ACG40852.1| cytochrome c oxidase assembly protein COX19 [Zea ... 137 2e-30 gb|AFW79120.1| hypothetical protein ZEAMMB73_460562 [Zea mays] 137 3e-30 >ref|XP_002515994.1| Cytochrome c oxidase assembly protein COX19, putative [Ricinus communis] gi|223544899|gb|EEF46414.1| Cytochrome c oxidase assembly protein COX19, putative [Ricinus communis] Length = 94 Score = 143 bits (361), Expect = 3e-32 Identities = 63/78 (80%), Positives = 71/78 (91%) Frame = -3 Query: 642 PVPPEKGVFPLDHMHQCDLEKKDYITCLKSEGHKSEKCRQFSKKYLECRMEKNLMAKQDM 463 PVPPEKG+FPLDHMH+CDLEKKDY+ CLKS GH+SEKCR FSKKYLECRMEKNLMA+QDM Sbjct: 15 PVPPEKGIFPLDHMHECDLEKKDYLNCLKSSGHQSEKCRLFSKKYLECRMEKNLMARQDM 74 Query: 462 SELGFRKEEESETSADRL 409 SELGFRKE + E S +R+ Sbjct: 75 SELGFRKEPDLEASGERI 92 >gb|ACG38035.1| cytochrome c oxidase assembly protein COX19 [Zea mays] gi|195652211|gb|ACG45573.1| cytochrome c oxidase assembly protein COX19 [Zea mays] Length = 109 Score = 139 bits (351), Expect = 5e-31 Identities = 62/76 (81%), Positives = 70/76 (92%) Frame = -3 Query: 642 PVPPEKGVFPLDHMHQCDLEKKDYITCLKSEGHKSEKCRQFSKKYLECRMEKNLMAKQDM 463 PVPPEKGVFPLDH+H+CDLEKKDY+ CLKS G +SEKCRQFSKKYLECRME+NLMAKQDM Sbjct: 15 PVPPEKGVFPLDHLHECDLEKKDYLACLKSTGFQSEKCRQFSKKYLECRMERNLMAKQDM 74 Query: 462 SELGFRKEEESETSAD 415 SELGFR +E++TS D Sbjct: 75 SELGFRNVDEADTSPD 90 >ref|XP_002468590.1| hypothetical protein SORBIDRAFT_01g048650 [Sorghum bicolor] gi|241922444|gb|EER95588.1| hypothetical protein SORBIDRAFT_01g048650 [Sorghum bicolor] Length = 109 Score = 139 bits (350), Expect = 6e-31 Identities = 62/76 (81%), Positives = 70/76 (92%) Frame = -3 Query: 642 PVPPEKGVFPLDHMHQCDLEKKDYITCLKSEGHKSEKCRQFSKKYLECRMEKNLMAKQDM 463 PVPPEKGVFPLDH+H+CDLEKKDY+ CLKS G +SEKCRQFSKKYLECRME+NLMAKQDM Sbjct: 15 PVPPEKGVFPLDHLHECDLEKKDYLACLKSTGFQSEKCRQFSKKYLECRMERNLMAKQDM 74 Query: 462 SELGFRKEEESETSAD 415 SELGFR +E++TS D Sbjct: 75 SELGFRNMDEADTSHD 90 >gb|ACG40852.1| cytochrome c oxidase assembly protein COX19 [Zea mays] Length = 104 Score = 137 bits (346), Expect = 2e-30 Identities = 62/77 (80%), Positives = 70/77 (90%) Frame = -3 Query: 642 PVPPEKGVFPLDHMHQCDLEKKDYITCLKSEGHKSEKCRQFSKKYLECRMEKNLMAKQDM 463 PVPPEKGVFPLDH+H+CDLEKKDY+ CLKS G +SEKCRQFSKKYLECRME+NLMAKQDM Sbjct: 15 PVPPEKGVFPLDHLHECDLEKKDYLGCLKSTGFQSEKCRQFSKKYLECRMERNLMAKQDM 74 Query: 462 SELGFRKEEESETSADR 412 SELGFR +E+ TS D+ Sbjct: 75 SELGFRTVDEAGTSPDK 91 >gb|AFW79120.1| hypothetical protein ZEAMMB73_460562 [Zea mays] Length = 104 Score = 137 bits (344), Expect = 3e-30 Identities = 62/77 (80%), Positives = 70/77 (90%) Frame = -3 Query: 642 PVPPEKGVFPLDHMHQCDLEKKDYITCLKSEGHKSEKCRQFSKKYLECRMEKNLMAKQDM 463 PVPPEKGVFPLDH+H+CDLEKKDY+ CLKS G +SEKCRQFSKKYLECRME+NLMAKQDM Sbjct: 15 PVPPEKGVFPLDHLHECDLEKKDYLGCLKSTGFQSEKCRQFSKKYLECRMERNLMAKQDM 74 Query: 462 SELGFRKEEESETSADR 412 SELGFR +E+ TS D+ Sbjct: 75 SELGFRIVDEAGTSPDK 91