BLASTX nr result
ID: Scutellaria24_contig00021242
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00021242 (309 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002301425.1| predicted protein [Populus trichocarpa] gi|2... 88 8e-16 ref|XP_002515830.1| ubiquitin-protein ligase, putative [Ricinus ... 82 3e-14 ref|XP_002264635.2| PREDICTED: U-box domain-containing protein 4... 82 4e-14 emb|CBI40591.3| unnamed protein product [Vitis vinifera] 82 4e-14 ref|XP_002320884.1| predicted protein [Populus trichocarpa] gi|2... 82 4e-14 >ref|XP_002301425.1| predicted protein [Populus trichocarpa] gi|222843151|gb|EEE80698.1| predicted protein [Populus trichocarpa] Length = 417 Score = 87.8 bits (216), Expect = 8e-16 Identities = 43/89 (48%), Positives = 63/89 (70%) Frame = +2 Query: 5 ENLKKFSAFLERSAFLLQELSKLEVKNLASINEALECLKPEIKVAKQLTSECCKGNKIYL 184 E+ K+FS +LER A +L+EL+K ++ + S+N A+E L EIK AKQLT++C K NK+YL Sbjct: 40 ESFKEFSVYLERVAPVLKELNKKDISHSRSLNSAIEILNQEIKAAKQLTADCTKRNKVYL 99 Query: 185 LLSCKRIVENLEMCTENISRAMSLFDLGS 271 L++ + I++NLE ISRA+ L L S Sbjct: 100 LMNSRTIIKNLEDIAREISRALGLLPLAS 128 >ref|XP_002515830.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223545059|gb|EEF46572.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 998 Score = 82.4 bits (202), Expect = 3e-14 Identities = 44/89 (49%), Positives = 61/89 (68%) Frame = +2 Query: 5 ENLKKFSAFLERSAFLLQELSKLEVKNLASINEALECLKPEIKVAKQLTSECCKGNKIYL 184 EN KFSA+LE++A +L+ELS L S+ A+E L + K+AK+L EC K +K+YL Sbjct: 94 ENFMKFSAYLEKTASVLRELSGLNSDYSESLRNAVEILNRKTKIAKRLVLECNKKSKVYL 153 Query: 185 LLSCKRIVENLEMCTENISRAMSLFDLGS 271 LL+C RIV +LE T+ IS+A+SL L S Sbjct: 154 LLNCHRIVSHLEDSTKEISQALSLIPLAS 182 >ref|XP_002264635.2| PREDICTED: U-box domain-containing protein 43-like [Vitis vinifera] Length = 1032 Score = 82.0 bits (201), Expect = 4e-14 Identities = 40/81 (49%), Positives = 56/81 (69%) Frame = +2 Query: 29 FLERSAFLLQELSKLEVKNLASINEALECLKPEIKVAKQLTSECCKGNKIYLLLSCKRIV 208 +L+R +L+EL+K + + S+N A+E L E KVAKQLT ECCK NK+YLL+ C+ +V Sbjct: 48 YLQRIIPILKELNKKGISHSESLNNAIEILNRETKVAKQLTLECCKKNKVYLLMHCRSVV 107 Query: 209 ENLEMCTENISRAMSLFDLGS 271 + LE T +SRA+SL L S Sbjct: 108 QRLENTTREMSRALSLIPLAS 128 >emb|CBI40591.3| unnamed protein product [Vitis vinifera] Length = 1006 Score = 82.0 bits (201), Expect = 4e-14 Identities = 40/81 (49%), Positives = 56/81 (69%) Frame = +2 Query: 29 FLERSAFLLQELSKLEVKNLASINEALECLKPEIKVAKQLTSECCKGNKIYLLLSCKRIV 208 +L+R +L+EL+K + + S+N A+E L E KVAKQLT ECCK NK+YLL+ C+ +V Sbjct: 48 YLQRIIPILKELNKKGISHSESLNNAIEILNRETKVAKQLTLECCKKNKVYLLMHCRSVV 107 Query: 209 ENLEMCTENISRAMSLFDLGS 271 + LE T +SRA+SL L S Sbjct: 108 QRLENTTREMSRALSLIPLAS 128 >ref|XP_002320884.1| predicted protein [Populus trichocarpa] gi|222861657|gb|EEE99199.1| predicted protein [Populus trichocarpa] Length = 691 Score = 82.0 bits (201), Expect = 4e-14 Identities = 42/98 (42%), Positives = 65/98 (66%) Frame = +2 Query: 5 ENLKKFSAFLERSAFLLQELSKLEVKNLASINEALECLKPEIKVAKQLTSECCKGNKIYL 184 ++ + S +LER A +L+EL+K ++ SIN A+ L EIK AKQLT++C K NK+YL Sbjct: 40 DSFTELSGYLERIAPVLKELNKKDIGCSGSINNAIGILNQEIKAAKQLTADCTKRNKVYL 99 Query: 185 LLSCKRIVENLEMCTENISRAMSLFDLGSSNTNEWLMK 298 L++C+ I ++LE T ISRA+ L L + + + L+K Sbjct: 100 LMNCRTITKSLEDITREISRALGLIPLANLDLSTGLIK 137