BLASTX nr result
ID: Scutellaria24_contig00021178
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00021178 (393 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003611996.1| hypothetical protein MTR_5g020150 [Medicago ... 61 1e-07 >ref|XP_003611996.1| hypothetical protein MTR_5g020150 [Medicago truncatula] gi|355513331|gb|AES94954.1| hypothetical protein MTR_5g020150 [Medicago truncatula] Length = 472 Score = 60.8 bits (146), Expect = 1e-07 Identities = 25/45 (55%), Positives = 37/45 (82%) Frame = +2 Query: 257 LGTIIILESIAVCCLGLMLLFFTCKCALLLVHEKKRQKSSDSLAN 391 LGTII++E + + CLGL+LL+FTCKCA+LLVHE+++ + S A+ Sbjct: 368 LGTIIVIEFVIIFCLGLLLLYFTCKCAILLVHERRKNEKRTSEAS 412