BLASTX nr result
ID: Scutellaria24_contig00021067
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00021067 (253 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003638270.1| DDB1- and CUL4-associated factor [Medicago t... 152 3e-35 ref|XP_003589324.1| DDB1- and CUL4-associated factor [Medicago t... 152 3e-35 ref|XP_003589323.1| DDB1- and CUL4-associated factor [Medicago t... 152 3e-35 ref|XP_002517863.1| U3 small nucleolar RNA (U3 snorna) associate... 150 1e-34 ref|XP_003519367.1| PREDICTED: DDB1- and CUL4-associated factor ... 149 2e-34 >ref|XP_003638270.1| DDB1- and CUL4-associated factor [Medicago truncatula] gi|355504205|gb|AES85408.1| DDB1- and CUL4-associated factor [Medicago truncatula] Length = 452 Score = 152 bits (384), Expect = 3e-35 Identities = 72/84 (85%), Positives = 80/84 (95%) Frame = -2 Query: 252 FTRERSQDLQRVFRNFDPSLRPQEKAVEYVRAVNAAKLDKIFARPFVGAMDGHVDAISSI 73 FTRERSQDLQRVFRN+DP LRPQEKAVEYVRA+NA KLDKIFARPF+GAMDGHVDAIS + Sbjct: 13 FTRERSQDLQRVFRNYDPILRPQEKAVEYVRALNAVKLDKIFARPFIGAMDGHVDAISCM 72 Query: 72 AKDPTRLKSVFSGSMDGDIRLWDL 1 AK+P++LK VFSGSMDGDIRLWD+ Sbjct: 73 AKNPSQLKEVFSGSMDGDIRLWDI 96 >ref|XP_003589324.1| DDB1- and CUL4-associated factor [Medicago truncatula] gi|355478372|gb|AES59575.1| DDB1- and CUL4-associated factor [Medicago truncatula] Length = 452 Score = 152 bits (384), Expect = 3e-35 Identities = 72/84 (85%), Positives = 80/84 (95%) Frame = -2 Query: 252 FTRERSQDLQRVFRNFDPSLRPQEKAVEYVRAVNAAKLDKIFARPFVGAMDGHVDAISSI 73 FTRERSQDLQRVFRN+DP LRPQEKAVEYVRA+NA KLDKIFARPF+GAMDGHVDAIS + Sbjct: 13 FTRERSQDLQRVFRNYDPILRPQEKAVEYVRALNAVKLDKIFARPFIGAMDGHVDAISCM 72 Query: 72 AKDPTRLKSVFSGSMDGDIRLWDL 1 AK+P++LK VFSGSMDGDIRLWD+ Sbjct: 73 AKNPSQLKEVFSGSMDGDIRLWDI 96 >ref|XP_003589323.1| DDB1- and CUL4-associated factor [Medicago truncatula] gi|355478371|gb|AES59574.1| DDB1- and CUL4-associated factor [Medicago truncatula] Length = 456 Score = 152 bits (384), Expect = 3e-35 Identities = 72/84 (85%), Positives = 80/84 (95%) Frame = -2 Query: 252 FTRERSQDLQRVFRNFDPSLRPQEKAVEYVRAVNAAKLDKIFARPFVGAMDGHVDAISSI 73 FTRERSQDLQRVFRN+DP LRPQEKAVEYVRA+NA KLDKIFARPF+GAMDGHVDAIS + Sbjct: 13 FTRERSQDLQRVFRNYDPILRPQEKAVEYVRALNAVKLDKIFARPFIGAMDGHVDAISCM 72 Query: 72 AKDPTRLKSVFSGSMDGDIRLWDL 1 AK+P++LK VFSGSMDGDIRLWD+ Sbjct: 73 AKNPSQLKEVFSGSMDGDIRLWDI 96 >ref|XP_002517863.1| U3 small nucleolar RNA (U3 snorna) associated protein, putative [Ricinus communis] gi|223542845|gb|EEF44381.1| U3 small nucleolar RNA (U3 snorna) associated protein, putative [Ricinus communis] Length = 452 Score = 150 bits (379), Expect = 1e-34 Identities = 70/84 (83%), Positives = 79/84 (94%) Frame = -2 Query: 252 FTRERSQDLQRVFRNFDPSLRPQEKAVEYVRAVNAAKLDKIFARPFVGAMDGHVDAISSI 73 FTRERSQDLQRVFRNFDPSLR QEK++EYVRA+NAAKLDKIFARPF+GAMDGH+DAIS + Sbjct: 13 FTRERSQDLQRVFRNFDPSLRTQEKSIEYVRALNAAKLDKIFARPFIGAMDGHIDAISCM 72 Query: 72 AKDPTRLKSVFSGSMDGDIRLWDL 1 AK+P LK +FSGSMDGDIRLWD+ Sbjct: 73 AKNPNYLKGIFSGSMDGDIRLWDI 96 >ref|XP_003519367.1| PREDICTED: DDB1- and CUL4-associated factor 13-like [Glycine max] Length = 452 Score = 149 bits (377), Expect = 2e-34 Identities = 69/84 (82%), Positives = 79/84 (94%) Frame = -2 Query: 252 FTRERSQDLQRVFRNFDPSLRPQEKAVEYVRAVNAAKLDKIFARPFVGAMDGHVDAISSI 73 FTRERSQDLQRVFRN+DPSLRPQEKAVEYVRAVNA KLDKIFARPF+GA+DGHVDA+S + Sbjct: 13 FTRERSQDLQRVFRNYDPSLRPQEKAVEYVRAVNAVKLDKIFARPFIGALDGHVDAVSCM 72 Query: 72 AKDPTRLKSVFSGSMDGDIRLWDL 1 ++P++LK +FS SMDGDIRLWDL Sbjct: 73 TRNPSQLKGIFSSSMDGDIRLWDL 96