BLASTX nr result
ID: Scutellaria24_contig00021054
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00021054 (394 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK39599.1| unknown [Lotus japonicus] 100 2e-19 ref|XP_002284123.1| PREDICTED: uncharacterized protein LOC100254... 98 8e-19 emb|CAN63279.1| hypothetical protein VITISV_023249 [Vitis vinifera] 98 8e-19 ref|XP_003533947.1| PREDICTED: uncharacterized protein LOC100795... 96 4e-18 ref|XP_002528981.1| metal ion binding protein, putative [Ricinus... 96 4e-18 >gb|AFK39599.1| unknown [Lotus japonicus] Length = 147 Score = 99.8 bits (247), Expect = 2e-19 Identities = 48/72 (66%), Positives = 58/72 (80%), Gaps = 1/72 (1%) Frame = +2 Query: 2 RRVNKTGKKAEFWPYIPYNAVQNSHVSQVYDKKAPPGYVRN-VQTLPVSNATTEEAITFL 178 ++V TGK+AEFWPYIPYN V +V+QVYDKKAPPGYV+N VQ LP NA ++ +T L Sbjct: 77 KKVQSTGKRAEFWPYIPYNLVAYPYVAQVYDKKAPPGYVKNSVQALPSPNA-LDDKLTNL 135 Query: 179 FSDDNPNACSIM 214 FSD+NPNACSIM Sbjct: 136 FSDENPNACSIM 147 >ref|XP_002284123.1| PREDICTED: uncharacterized protein LOC100254317 isoform 1 [Vitis vinifera] gi|297737722|emb|CBI26923.3| unnamed protein product [Vitis vinifera] Length = 147 Score = 97.8 bits (242), Expect = 8e-19 Identities = 46/72 (63%), Positives = 56/72 (77%), Gaps = 1/72 (1%) Frame = +2 Query: 2 RRVNKTGKKAEFWPYIPYNAVQNSHVSQVYDKKAPPGYVRN-VQTLPVSNATTEEAITFL 178 +RV TGK+AEFWPY+PYN V ++ + YDKKAP GYV+N VQ LP S + T+E +T L Sbjct: 77 KRVKSTGKRAEFWPYVPYNLVYYPYIKEAYDKKAPSGYVKNVVQALP-SPSATDERLTTL 135 Query: 179 FSDDNPNACSIM 214 FSDDNPNACSIM Sbjct: 136 FSDDNPNACSIM 147 >emb|CAN63279.1| hypothetical protein VITISV_023249 [Vitis vinifera] Length = 170 Score = 97.8 bits (242), Expect = 8e-19 Identities = 46/72 (63%), Positives = 56/72 (77%), Gaps = 1/72 (1%) Frame = +2 Query: 2 RRVNKTGKKAEFWPYIPYNAVQNSHVSQVYDKKAPPGYVRN-VQTLPVSNATTEEAITFL 178 +RV TGK+AEFWPY+PYN V ++ + YDKKAP GYV+N VQ LP S + T+E +T L Sbjct: 77 KRVKSTGKRAEFWPYVPYNLVYYPYIKEAYDKKAPSGYVKNVVQALP-SPSATDERLTTL 135 Query: 179 FSDDNPNACSIM 214 FSDDNPNACSIM Sbjct: 136 FSDDNPNACSIM 147 >ref|XP_003533947.1| PREDICTED: uncharacterized protein LOC100795068 [Glycine max] Length = 147 Score = 95.5 bits (236), Expect = 4e-18 Identities = 45/72 (62%), Positives = 56/72 (77%), Gaps = 1/72 (1%) Frame = +2 Query: 2 RRVNKTGKKAEFWPYIPYNAVQNSHVSQVYDKKAPPGYVRN-VQTLPVSNATTEEAITFL 178 ++V TGK+A+FWPYIPYN V +V+Q YDKKAP GYV+N Q LP SN + +E +T L Sbjct: 77 KKVQSTGKRADFWPYIPYNLVAYPYVAQAYDKKAPSGYVKNAAQALPASN-SLDEKLTSL 135 Query: 179 FSDDNPNACSIM 214 FSD+NPNACSIM Sbjct: 136 FSDENPNACSIM 147 >ref|XP_002528981.1| metal ion binding protein, putative [Ricinus communis] gi|223531571|gb|EEF33400.1| metal ion binding protein, putative [Ricinus communis] Length = 153 Score = 95.5 bits (236), Expect = 4e-18 Identities = 42/73 (57%), Positives = 52/73 (71%), Gaps = 2/73 (2%) Frame = +2 Query: 2 RRVNKTGKKAEFWPYIPYNAVQNSHVSQVYDKKAPPGYVRNVQTLPVSNATT--EEAITF 175 ++ TGKKAE WPY+PYN V +++Q YDKKAPPGYVRNV+ S T E+ + Sbjct: 81 KKAKSTGKKAEIWPYVPYNLVAQPYIAQAYDKKAPPGYVRNVENTATSGTVTRYEDPYSS 140 Query: 176 LFSDDNPNACSIM 214 +FSDDNPNACSIM Sbjct: 141 MFSDDNPNACSIM 153