BLASTX nr result
ID: Scutellaria24_contig00021016
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00021016 (249 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516441.1| conserved hypothetical protein [Ricinus comm... 65 7e-09 ref|XP_004141316.1| PREDICTED: uncharacterized protein LOC101208... 62 5e-08 ref|XP_002279406.1| PREDICTED: uncharacterized protein LOC100249... 60 2e-07 ref|XP_002324174.1| predicted protein [Populus trichocarpa] gi|2... 60 2e-07 gb|ABK95362.1| unknown [Populus trichocarpa] 60 2e-07 >ref|XP_002516441.1| conserved hypothetical protein [Ricinus communis] gi|223544261|gb|EEF45782.1| conserved hypothetical protein [Ricinus communis] Length = 316 Score = 64.7 bits (156), Expect = 7e-09 Identities = 32/47 (68%), Positives = 37/47 (78%) Frame = +3 Query: 87 MLEESASAIPSSVWASMNSWFTPIVLFLLLNLMIGTIAFTSTFSGNK 227 M EES ++IPS +WASMNSWFTP VLFL LNLMIGTI TS+ + K Sbjct: 1 MFEESVTSIPS-IWASMNSWFTPTVLFLFLNLMIGTIYVTSSLATQK 46 >ref|XP_004141316.1| PREDICTED: uncharacterized protein LOC101208392 [Cucumis sativus] gi|449486625|ref|XP_004157351.1| PREDICTED: uncharacterized protein LOC101225137 [Cucumis sativus] Length = 377 Score = 62.0 bits (149), Expect = 5e-08 Identities = 29/54 (53%), Positives = 37/54 (68%) Frame = +3 Query: 87 MLEESASAIPSSVWASMNSWFTPIVLFLLLNLMIGTIAFTSTFSGNKHRHNHHP 248 ML ES S+ S+W S+NSWFTP VLF++LNL+IGTIA S G + + HP Sbjct: 1 MLAESVSST-LSIWTSLNSWFTPTVLFVVLNLVIGTIAIASNLGGTQRTNQRHP 53 >ref|XP_002279406.1| PREDICTED: uncharacterized protein LOC100249297 [Vitis vinifera] Length = 249 Score = 60.1 bits (144), Expect = 2e-07 Identities = 33/41 (80%), Positives = 34/41 (82%) Frame = +3 Query: 87 MLEESASAIPSSVWASMNSWFTPIVLFLLLNLMIGTIAFTS 209 M EES S IPS +WASMNSWFTP VLFLLLNLMIGTI TS Sbjct: 1 MFEESMS-IPS-IWASMNSWFTPAVLFLLLNLMIGTIFVTS 39 >ref|XP_002324174.1| predicted protein [Populus trichocarpa] gi|222865608|gb|EEF02739.1| predicted protein [Populus trichocarpa] Length = 315 Score = 60.1 bits (144), Expect = 2e-07 Identities = 31/52 (59%), Positives = 37/52 (71%) Frame = +3 Query: 87 MLEESASAIPSSVWASMNSWFTPIVLFLLLNLMIGTIAFTSTFSGNKHRHNH 242 MLEES S +WASM+SWFTP VLF+LLNLMIGTI TS+ + +K H Sbjct: 1 MLEESMS-----IWASMSSWFTPTVLFVLLNLMIGTIFITSSIATHKPSDQH 47 >gb|ABK95362.1| unknown [Populus trichocarpa] Length = 315 Score = 60.1 bits (144), Expect = 2e-07 Identities = 31/52 (59%), Positives = 37/52 (71%) Frame = +3 Query: 87 MLEESASAIPSSVWASMNSWFTPIVLFLLLNLMIGTIAFTSTFSGNKHRHNH 242 MLEES S +WASM+SWFTP VLF+LLNLMIGTI TS+ + +K H Sbjct: 1 MLEESMS-----IWASMSSWFTPTVLFVLLNLMIGTIFITSSIATHKPSDQH 47