BLASTX nr result
ID: Scutellaria24_contig00020903
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00020903 (829 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513901.1| conserved hypothetical protein [Ricinus comm... 71 3e-10 ref|XP_002304819.1| predicted protein [Populus trichocarpa] gi|2... 62 2e-07 >ref|XP_002513901.1| conserved hypothetical protein [Ricinus communis] gi|223546987|gb|EEF48484.1| conserved hypothetical protein [Ricinus communis] Length = 380 Score = 70.9 bits (172), Expect = 3e-10 Identities = 35/96 (36%), Positives = 58/96 (60%) Frame = +1 Query: 1 FRQAPPVFSVSAEKMIKVKEVVLASGKYDISCIAKSPTSLCRSIEKWYKPKMQVLGILEA 180 F++ P F++S K+ V +++L G DIS I + P L S+ + KP++ VL +LE Sbjct: 278 FKRVPQAFAISERKIKDVTKLLLNVGNLDISYIVRHPDLLICSVNQRLKPRLAVLQVLEN 337 Query: 181 KNLISKWPNFTTLCRMTEKSFYTKFVAPYLDEVVDV 288 K L+ K P+FT+ +++ F K+V PY DE+ D+ Sbjct: 338 KKLLQKKPSFTSFFKISGSQFLHKYVIPYSDELGDL 373 >ref|XP_002304819.1| predicted protein [Populus trichocarpa] gi|222842251|gb|EEE79798.1| predicted protein [Populus trichocarpa] Length = 366 Score = 61.6 bits (148), Expect = 2e-07 Identities = 31/93 (33%), Positives = 54/93 (58%) Frame = +1 Query: 1 FRQAPPVFSVSAEKMIKVKEVVLASGKYDISCIAKSPTSLCRSIEKWYKPKMQVLGILEA 180 F++ PP+F S +K+ + + + + + I KSP L SI+K +P+ V+ +LE+ Sbjct: 260 FKRHPPLFGYSEKKIRTAMDFFINTMELERQFIIKSPNFLGMSIDKRIRPRYNVIKVLES 319 Query: 181 KNLISKWPNFTTLCRMTEKSFYTKFVAPYLDEV 279 K LI + +TL ++EK+F+ +V Y DEV Sbjct: 320 KELIKRDKKISTLLSLSEKNFWANYVIKYADEV 352