BLASTX nr result
ID: Scutellaria24_contig00020824
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00020824 (311 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN67815.1| hypothetical protein VITISV_002502 [Vitis vinifera] 80 2e-13 ref|XP_002529848.1| DNA repair and recombination protein RAD26, ... 78 6e-13 emb|CBI37137.3| unnamed protein product [Vitis vinifera] 77 2e-12 ref|XP_002272543.1| PREDICTED: DNA excision repair protein ERCC-... 77 2e-12 ref|XP_002307656.1| chromatin remodeling complex subunit [Populu... 75 4e-12 >emb|CAN67815.1| hypothetical protein VITISV_002502 [Vitis vinifera] Length = 1249 Score = 80.1 bits (196), Expect = 2e-13 Identities = 41/80 (51%), Positives = 51/80 (63%) Frame = -3 Query: 309 QLMSEASKARPTTKMLDPESLPKLDAPSRPFQRLGAPLKISRSLXXXXXXXXXXXXXXXR 130 Q +SE+++ARPTTKMLD E+LPKLDAPS PF RL PLK L R Sbjct: 296 QSISESAQARPTTKMLDSETLPKLDAPSHPFHRLKKPLKYPLPLDSEVEKNKDKKRKKKR 355 Query: 129 PQPGKKWKRLVSREEKFLGE 70 P PGKKW++++S EE+ L E Sbjct: 356 PLPGKKWRKIISHEEELLEE 375 >ref|XP_002529848.1| DNA repair and recombination protein RAD26, putative [Ricinus communis] gi|223530676|gb|EEF32549.1| DNA repair and recombination protein RAD26, putative [Ricinus communis] Length = 1230 Score = 78.2 bits (191), Expect = 6e-13 Identities = 39/80 (48%), Positives = 51/80 (63%) Frame = -3 Query: 309 QLMSEASKARPTTKMLDPESLPKLDAPSRPFQRLGAPLKISRSLXXXXXXXXXXXXXXXR 130 Q M EA+KARP TK+LD +++PKLDAP+RPFQRL PL+ SL R Sbjct: 273 QSMLEAAKARPVTKLLDSDAVPKLDAPTRPFQRLKTPLQFPHSLENASDKTKGSKRKTKR 332 Query: 129 PQPGKKWKRLVSREEKFLGE 70 P PG+KW++ ++REE L E Sbjct: 333 PLPGQKWRKRITREENHLEE 352 >emb|CBI37137.3| unnamed protein product [Vitis vinifera] Length = 1116 Score = 76.6 bits (187), Expect = 2e-12 Identities = 39/80 (48%), Positives = 50/80 (62%) Frame = -3 Query: 309 QLMSEASKARPTTKMLDPESLPKLDAPSRPFQRLGAPLKISRSLXXXXXXXXXXXXXXXR 130 Q +SE+++ARPTTK+LD E+LPKLDAPS PF RL PLK L R Sbjct: 274 QSISESAQARPTTKLLDSETLPKLDAPSHPFHRLKKPLKYPLPLDSEVEKNKDKKRKKKR 333 Query: 129 PQPGKKWKRLVSREEKFLGE 70 P P KKW++++S EE+ L E Sbjct: 334 PLPSKKWRKIISHEEELLEE 353 >ref|XP_002272543.1| PREDICTED: DNA excision repair protein ERCC-6-like [Vitis vinifera] Length = 1227 Score = 76.6 bits (187), Expect = 2e-12 Identities = 39/80 (48%), Positives = 50/80 (62%) Frame = -3 Query: 309 QLMSEASKARPTTKMLDPESLPKLDAPSRPFQRLGAPLKISRSLXXXXXXXXXXXXXXXR 130 Q +SE+++ARPTTK+LD E+LPKLDAPS PF RL PLK L R Sbjct: 274 QSISESAQARPTTKLLDSETLPKLDAPSHPFHRLKKPLKYPLPLDSEVEKNKDKKRKKKR 333 Query: 129 PQPGKKWKRLVSREEKFLGE 70 P P KKW++++S EE+ L E Sbjct: 334 PLPSKKWRKIISHEEELLEE 353 >ref|XP_002307656.1| chromatin remodeling complex subunit [Populus trichocarpa] gi|222857105|gb|EEE94652.1| chromatin remodeling complex subunit [Populus trichocarpa] Length = 1206 Score = 75.5 bits (184), Expect = 4e-12 Identities = 42/82 (51%), Positives = 51/82 (62%) Frame = -3 Query: 303 MSEASKARPTTKMLDPESLPKLDAPSRPFQRLGAPLKISRSLXXXXXXXXXXXXXXXRPQ 124 M EA+KARPTTK+LD E+LPKLDAP+RPFQRL PLK +S RP Sbjct: 272 MLEAAKARPTTKLLDSEALPKLDAPTRPFQRLKTPLKACQSPERDAEKRKGSERKRKRPL 331 Query: 123 PGKKWKRLVSREEKFLGEGGTS 58 PGKKW++ S E+ +GE S Sbjct: 332 PGKKWRKSASWED--MGESEDS 351