BLASTX nr result
ID: Scutellaria24_contig00020301
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00020301 (476 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN63320.1| hypothetical protein VITISV_026425 [Vitis vinifera] 70 1e-10 ref|XP_003631786.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 >emb|CAN63320.1| hypothetical protein VITISV_026425 [Vitis vinifera] Length = 722 Score = 70.5 bits (171), Expect = 1e-10 Identities = 29/55 (52%), Positives = 39/55 (70%) Frame = -1 Query: 476 RGMFWEIISLFKDMAMDGCKPNEGSFELLRRAKISSWMKGFPRAVQMIEFIMHGN 312 RG FW+I+SL KDM MDGC+PN S E+L++A WMK FP + +EF++ GN Sbjct: 656 RGKFWDIVSLLKDMTMDGCEPNAVSIEILKQAMSKCWMKRFPEVSKQLEFVICGN 710 >ref|XP_003631786.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, mitochondrial-like [Vitis vinifera] Length = 629 Score = 63.5 bits (153), Expect = 2e-08 Identities = 29/69 (42%), Positives = 45/69 (65%) Frame = -1 Query: 476 RGMFWEIISLFKDMAMDGCKPNEGSFELLRRAKISSWMKGFPRAVQMIEFIMHGNMIE*R 297 RG FW+I+SL KDM MDGC+PN S E+L++A WMK FP +++ +++H + + Sbjct: 548 RGKFWDIVSLLKDMTMDGCEPNAVSIEILKQAMSKCWMKRFPEFIEL--WVVHLSGPDIT 605 Query: 296 VFQELVEFV 270 ++ EL V Sbjct: 606 IWSELQTMV 614