BLASTX nr result
ID: Scutellaria24_contig00020216
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00020216 (310 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN74806.1| hypothetical protein VITISV_022136 [Vitis vinifera] 56 3e-06 emb|CBI34161.3| unnamed protein product [Vitis vinifera] 55 8e-06 ref|XP_002279520.1| PREDICTED: light-inducible protein CPRF2-lik... 55 8e-06 >emb|CAN74806.1| hypothetical protein VITISV_022136 [Vitis vinifera] Length = 446 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +1 Query: 1 PPLNIPLDSDEYQAVLKSRLELACAAVALSRV 96 PP N+P+DS+EYQA LKSRL LACAAVALSRV Sbjct: 90 PPPNVPIDSEEYQAFLKSRLNLACAAVALSRV 121 >emb|CBI34161.3| unnamed protein product [Vitis vinifera] Length = 383 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +1 Query: 1 PPLNIPLDSDEYQAVLKSRLELACAAVALSRVN 99 PP N+P+DS+EYQA LKSRL LACAAVALSR + Sbjct: 92 PPPNVPIDSEEYQAFLKSRLNLACAAVALSRAS 124 >ref|XP_002279520.1| PREDICTED: light-inducible protein CPRF2-like [Vitis vinifera] Length = 423 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +1 Query: 1 PPLNIPLDSDEYQAVLKSRLELACAAVALSRVN 99 PP N+P+DS+EYQA LKSRL LACAAVALSR + Sbjct: 92 PPPNVPIDSEEYQAFLKSRLNLACAAVALSRAS 124