BLASTX nr result
ID: Scutellaria24_contig00020146
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00020146 (661 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002303299.1| predicted protein [Populus trichocarpa] gi|2... 71 2e-17 emb|CBI36104.3| unnamed protein product [Vitis vinifera] 70 3e-17 ref|XP_002279039.1| PREDICTED: uncharacterized WD repeat-contain... 70 3e-17 ref|XP_003542094.1| PREDICTED: uncharacterized WD repeat-contain... 68 8e-17 ref|XP_002516001.1| F-box and wd40 domain protein, putative [Ric... 69 4e-16 >ref|XP_002303299.1| predicted protein [Populus trichocarpa] gi|222840731|gb|EEE78278.1| predicted protein [Populus trichocarpa] Length = 239 Score = 70.9 bits (172), Expect(3) = 2e-17 Identities = 35/56 (62%), Positives = 42/56 (75%), Gaps = 1/56 (1%) Frame = -3 Query: 308 DFKCIVTIQAHSEPINVVALADDGII*IVSDDATVSVWRLNF-NGACLHSLTVTLN 144 D KCI TIQAH EP+N V +ADDGI+ SDDA++ VWR NF +G HSLTVTL+ Sbjct: 35 DLKCIETIQAHLEPVNAVVVADDGILYTASDDASIRVWRRNFCSGEWPHSLTVTLS 90 Score = 38.1 bits (87), Expect(3) = 2e-17 Identities = 15/27 (55%), Positives = 21/27 (77%) Frame = -1 Query: 142 EYSQIKT*VLTFDGGVLYGGYTEGYVH 62 ++S ++T LT D GVLYGG T+GY+H Sbjct: 92 KHSPVRTLTLTSDNGVLYGGCTDGYIH 118 Score = 25.4 bits (54), Expect(3) = 2e-17 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = -2 Query: 345 SLDKTVKVWRI 313 SLD+TVKVWRI Sbjct: 23 SLDRTVKVWRI 33 >emb|CBI36104.3| unnamed protein product [Vitis vinifera] Length = 923 Score = 70.5 bits (171), Expect(3) = 3e-17 Identities = 34/55 (61%), Positives = 42/55 (76%), Gaps = 1/55 (1%) Frame = -3 Query: 308 DFKCIVTIQAHSEPINVVALADDGII*IVSDDATVSVWRLNF-NGACLHSLTVTL 147 D KCI TIQAH++P+N + +ADDG++ SDDATV VWR NF +G HSLTVTL Sbjct: 229 DHKCIETIQAHTDPVNAIVVADDGVLYTASDDATVRVWRRNFCSGDRPHSLTVTL 283 Score = 37.0 bits (84), Expect(3) = 3e-17 Identities = 16/25 (64%), Positives = 19/25 (76%) Frame = -1 Query: 136 SQIKT*VLTFDGGVLYGGYTEGYVH 62 S +KT LT DG VLYGG T+GY+H Sbjct: 288 SPVKTLSLTGDGAVLYGGCTDGYIH 312 Score = 26.6 bits (57), Expect(3) = 3e-17 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 345 SLDKTVKVWRI 313 SLDKTVKVWRI Sbjct: 217 SLDKTVKVWRI 227 >ref|XP_002279039.1| PREDICTED: uncharacterized WD repeat-containing protein alr3466 [Vitis vinifera] Length = 427 Score = 70.5 bits (171), Expect(3) = 3e-17 Identities = 34/55 (61%), Positives = 42/55 (76%), Gaps = 1/55 (1%) Frame = -3 Query: 308 DFKCIVTIQAHSEPINVVALADDGII*IVSDDATVSVWRLNF-NGACLHSLTVTL 147 D KCI TIQAH++P+N + +ADDG++ SDDATV VWR NF +G HSLTVTL Sbjct: 229 DHKCIETIQAHTDPVNAIVVADDGVLYTASDDATVRVWRRNFCSGDRPHSLTVTL 283 Score = 37.0 bits (84), Expect(3) = 3e-17 Identities = 16/25 (64%), Positives = 19/25 (76%) Frame = -1 Query: 136 SQIKT*VLTFDGGVLYGGYTEGYVH 62 S +KT LT DG VLYGG T+GY+H Sbjct: 288 SPVKTLSLTGDGAVLYGGCTDGYIH 312 Score = 26.6 bits (57), Expect(3) = 3e-17 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 345 SLDKTVKVWRI 313 SLDKTVKVWRI Sbjct: 217 SLDKTVKVWRI 227 >ref|XP_003542094.1| PREDICTED: uncharacterized WD repeat-containing protein all2124-like [Glycine max] Length = 441 Score = 67.8 bits (164), Expect(3) = 8e-17 Identities = 34/56 (60%), Positives = 42/56 (75%), Gaps = 1/56 (1%) Frame = -3 Query: 308 DFKCIVTIQAHSEPINVVALADDGII*IVSDDATVSVWRLNF-NGACLHSLTVTLN 144 D KCI TI+AH+EPIN + +ADDG++ SDDATV VWR NF + HSLTVTL+ Sbjct: 233 DMKCIETIKAHTEPINAIIVADDGVLYTASDDATVRVWRRNFCSHDQPHSLTVTLH 288 Score = 38.1 bits (87), Expect(3) = 8e-17 Identities = 15/27 (55%), Positives = 20/27 (74%) Frame = -1 Query: 142 EYSQIKT*VLTFDGGVLYGGYTEGYVH 62 +YS +K LT D G+LYGG T+GY+H Sbjct: 290 KYSPVKALTLTPDAGILYGGCTDGYIH 316 Score = 26.6 bits (57), Expect(3) = 8e-17 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 345 SLDKTVKVWRI 313 SLDKTVKVWRI Sbjct: 221 SLDKTVKVWRI 231 >ref|XP_002516001.1| F-box and wd40 domain protein, putative [Ricinus communis] gi|223544906|gb|EEF46421.1| F-box and wd40 domain protein, putative [Ricinus communis] Length = 333 Score = 68.6 bits (166), Expect(3) = 4e-16 Identities = 34/55 (61%), Positives = 39/55 (70%), Gaps = 1/55 (1%) Frame = -3 Query: 308 DFKCIVTIQAHSEPINVVALADDGII*IVSDDATVSVWRLNF-NGACLHSLTVTL 147 D +CI TIQAHSEPIN + +ADDG++ SDDATV VWR NF G HSL V L Sbjct: 128 DLRCIETIQAHSEPINAIVVADDGVLYTASDDATVKVWRRNFCTGDWPHSLIVVL 182 Score = 36.2 bits (82), Expect(3) = 4e-16 Identities = 14/27 (51%), Positives = 20/27 (74%) Frame = -1 Query: 142 EYSQIKT*VLTFDGGVLYGGYTEGYVH 62 ++S +KT LT D +LYGG T+GY+H Sbjct: 185 KFSPVKTLTLTADNRILYGGCTDGYIH 211 Score = 25.4 bits (54), Expect(3) = 4e-16 Identities = 9/11 (81%), Positives = 11/11 (100%) Frame = -2 Query: 345 SLDKTVKVWRI 313 SLDKTVK+WR+ Sbjct: 116 SLDKTVKIWRL 126