BLASTX nr result
ID: Scutellaria24_contig00020082
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00020082 (298 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002282063.1| PREDICTED: pentatricopeptide repeat-containi... 86 2e-15 emb|CAN65024.1| hypothetical protein VITISV_026273 [Vitis vinifera] 86 4e-15 ref|XP_003525932.1| PREDICTED: pentatricopeptide repeat-containi... 85 7e-15 ref|XP_002517451.1| pentatricopeptide repeat-containing protein,... 66 3e-09 ref|XP_003520106.1| PREDICTED: pentatricopeptide repeat-containi... 64 1e-08 >ref|XP_002282063.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Vitis vinifera] Length = 533 Score = 86.3 bits (212), Expect = 2e-15 Identities = 45/78 (57%), Positives = 53/78 (67%) Frame = -3 Query: 296 NIYRESGWDTEAMSVRRLMENKQMKKKPGCSVIEVNGMVEEFLAGDVSHPQALEISLILH 117 N+YRE+GWD EA VRRL+ MKKKPGCS+IEV+G VEEFLAGD+SH QA +I L Sbjct: 460 NLYREAGWDMEAKRVRRLISEAGMKKKPGCSIIEVDGTVEEFLAGDLSHSQAPQICKTLD 519 Query: 116 SLLPHEIINQ*SSLLCYN 63 SL + L CYN Sbjct: 520 SL------SNIGRLECYN 531 >emb|CAN65024.1| hypothetical protein VITISV_026273 [Vitis vinifera] Length = 805 Score = 85.5 bits (210), Expect = 4e-15 Identities = 41/62 (66%), Positives = 48/62 (77%) Frame = -3 Query: 296 NIYRESGWDTEAMSVRRLMENKQMKKKPGCSVIEVNGMVEEFLAGDVSHPQALEISLILH 117 N+YRE+GWD EA VRRL+ MKKKPGCS+IEV+G VEEFLAGD+SH QA +I L Sbjct: 732 NLYREAGWDMEAKRVRRLISEXGMKKKPGCSIIEVDGTVEEFLAGDLSHSQAPQICKTLD 791 Query: 116 SL 111 SL Sbjct: 792 SL 793 >ref|XP_003525932.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Glycine max] Length = 526 Score = 84.7 bits (208), Expect = 7e-15 Identities = 41/63 (65%), Positives = 48/63 (76%) Frame = -3 Query: 296 NIYRESGWDTEAMSVRRLMENKQMKKKPGCSVIEVNGMVEEFLAGDVSHPQALEISLILH 117 NIYRE+GWD EA VR +E MKKKPGCS+IEV+ VEEFLAGD SHPQA E+ +L Sbjct: 456 NIYREAGWDVEANKVRSRIEEVGMKKKPGCSIIEVDNEVEEFLAGDHSHPQAQEMCKLLD 515 Query: 116 SLL 108 S+L Sbjct: 516 SIL 518 >ref|XP_002517451.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223543462|gb|EEF44993.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 428 Score = 65.9 bits (159), Expect = 3e-09 Identities = 31/64 (48%), Positives = 43/64 (67%) Frame = -3 Query: 296 NIYRESGWDTEAMSVRRLMENKQMKKKPGCSVIEVNGMVEEFLAGDVSHPQALEISLILH 117 NIY +G +A + RL+ + +KK PGCS+IEVNGMV EF++GDVS+ ++ IL Sbjct: 346 NIYLSTGRGEDASKIHRLIGERGLKKTPGCSMIEVNGMVNEFVSGDVSNKDVAQMHAILE 405 Query: 116 SLLP 105 LLP Sbjct: 406 LLLP 409 >ref|XP_003520106.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540-like [Glycine max] Length = 518 Score = 64.3 bits (155), Expect = 1e-08 Identities = 29/62 (46%), Positives = 42/62 (67%) Frame = -3 Query: 296 NIYRESGWDTEAMSVRRLMENKQMKKKPGCSVIEVNGMVEEFLAGDVSHPQALEISLILH 117 N+Y SG ++A VR +M NK + K PGCS +E++G+V EF+AG+ +HPQ EI +L Sbjct: 452 NLYAASGKHSDARRVRNMMRNKGVDKAPGCSSVEIDGVVSEFIAGEETHPQMEEIHSVLE 511 Query: 116 SL 111 L Sbjct: 512 IL 513