BLASTX nr result
ID: Scutellaria24_contig00019944
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00019944 (207 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI29627.3| unnamed protein product [Vitis vinifera] 67 2e-09 ref|XP_003543386.1| PREDICTED: 22.7 kDa class IV heat shock prot... 65 4e-09 ref|NP_001235147.1| low molecular weight heat shock protein Hsp2... 64 1e-08 gb|ADU55786.1| HSP22.9 [Citrullus lanatus] 64 1e-08 ref|XP_004136960.1| PREDICTED: 22.7 kDa class IV heat shock prot... 64 2e-08 >emb|CBI29627.3| unnamed protein product [Vitis vinifera] Length = 284 Score = 66.6 bits (161), Expect = 2e-09 Identities = 34/69 (49%), Positives = 44/69 (63%) Frame = +1 Query: 1 RISGXXXXXXXXXXXXXXXXXXTVGKFWRQFRLPANADMEKVRARLENGVLRISVGKLSE 180 RISG GKFWRQFRLPANAD+++++A LENGVLRI++ KL+E Sbjct: 169 RISGERTAEGEAEGEKWHRSERATGKFWRQFRLPANADLDRIKAHLENGVLRITIPKLAE 228 Query: 181 SETKKKEAK 207 +KK+AK Sbjct: 229 D--RKKQAK 235 >ref|XP_003543386.1| PREDICTED: 22.7 kDa class IV heat shock protein-like [Glycine max] Length = 198 Score = 65.5 bits (158), Expect = 4e-09 Identities = 33/47 (70%), Positives = 38/47 (80%) Frame = +1 Query: 67 TVGKFWRQFRLPANADMEKVRARLENGVLRISVGKLSESETKKKEAK 207 T GKFWRQFRLP NAD+EKV ARLE+GVLRI+V KL E KK++ K Sbjct: 133 TNGKFWRQFRLPLNADLEKVTARLEDGVLRITVAKLGED--KKRQPK 177 >ref|NP_001235147.1| low molecular weight heat shock protein Hsp22.3 precursor [Glycine max] gi|710434|gb|AAB03097.1| Hsp22.3 [Glycine max] Length = 197 Score = 63.9 bits (154), Expect = 1e-08 Identities = 33/47 (70%), Positives = 37/47 (78%) Frame = +1 Query: 67 TVGKFWRQFRLPANADMEKVRARLENGVLRISVGKLSESETKKKEAK 207 T GKF RQFRLP NAD+EKV ARLENGVLRI+VGK E KK++ K Sbjct: 132 TNGKFMRQFRLPVNADLEKVTARLENGVLRITVGKFGED--KKRQPK 176 >gb|ADU55786.1| HSP22.9 [Citrullus lanatus] Length = 200 Score = 63.9 bits (154), Expect = 1e-08 Identities = 30/45 (66%), Positives = 38/45 (84%) Frame = +1 Query: 73 GKFWRQFRLPANADMEKVRARLENGVLRISVGKLSESETKKKEAK 207 G+FWRQFRLPANAD+E++RA LENGVL++ V KL + KK+EAK Sbjct: 136 GRFWRQFRLPANADVERIRAHLENGVLKVIVPKLPQE--KKREAK 178 >ref|XP_004136960.1| PREDICTED: 22.7 kDa class IV heat shock protein-like [Cucumis sativus] gi|449495657|ref|XP_004159906.1| PREDICTED: 22.7 kDa class IV heat shock protein-like [Cucumis sativus] Length = 197 Score = 63.5 bits (153), Expect = 2e-08 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = +1 Query: 73 GKFWRQFRLPANADMEKVRARLENGVLRISVGKLSESETKKKEAK 207 GKFWRQFRLP NADME ++A LENGVL++ V KL + KKKEAK Sbjct: 133 GKFWRQFRLPGNADMEGIKAHLENGVLKVIVPKLPQE--KKKEAK 175