BLASTX nr result
ID: Scutellaria24_contig00019897
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00019897 (519 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004163385.1| PREDICTED: LOW QUALITY PROTEIN: aspartic pro... 63 3e-08 ref|XP_004147327.1| PREDICTED: aspartic proteinase Asp1-like [Cu... 63 3e-08 dbj|BAD80835.1| nucellin-like protein [Daucus carota] 61 1e-07 ref|XP_003602685.1| Aspartic proteinase Asp1 [Medicago truncatul... 61 1e-07 ref|XP_002273988.1| PREDICTED: aspartic proteinase Asp1 [Vitis v... 60 1e-07 >ref|XP_004163385.1| PREDICTED: LOW QUALITY PROTEIN: aspartic proteinase Asp1-like [Cucumis sativus] Length = 418 Score = 62.8 bits (151), Expect = 3e-08 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 121 FYFVQVYLGYPPRPYFLDPDTGSDLTWLQCD 29 FY V +Y+G PP+PYFLDPDTGSDLTWLQCD Sbjct: 56 FYNVTLYVGQPPKPYFLDPDTGSDLTWLQCD 86 >ref|XP_004147327.1| PREDICTED: aspartic proteinase Asp1-like [Cucumis sativus] Length = 418 Score = 62.8 bits (151), Expect = 3e-08 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 121 FYFVQVYLGYPPRPYFLDPDTGSDLTWLQCD 29 FY V +Y+G PP+PYFLDPDTGSDLTWLQCD Sbjct: 56 FYNVTLYVGQPPKPYFLDPDTGSDLTWLQCD 86 >dbj|BAD80835.1| nucellin-like protein [Daucus carota] Length = 426 Score = 60.8 bits (146), Expect = 1e-07 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = -3 Query: 121 FYFVQVYLGYPPRPYFLDPDTGSDLTWLQCD 29 +Y VQ +G PP+PYFLDPDTGSDLTWLQCD Sbjct: 66 YYHVQFNIGQPPKPYFLDPDTGSDLTWLQCD 96 >ref|XP_003602685.1| Aspartic proteinase Asp1 [Medicago truncatula] gi|355491733|gb|AES72936.1| Aspartic proteinase Asp1 [Medicago truncatula] Length = 440 Score = 60.8 bits (146), Expect = 1e-07 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -3 Query: 121 FYFVQVYLGYPPRPYFLDPDTGSDLTWLQCD 29 FY V + +GYPPRPYFLD DTGSDLTWLQCD Sbjct: 84 FYNVTINIGYPPRPYFLDIDTGSDLTWLQCD 114 >ref|XP_002273988.1| PREDICTED: aspartic proteinase Asp1 [Vitis vinifera] gi|296082608|emb|CBI21613.3| unnamed protein product [Vitis vinifera] Length = 426 Score = 60.5 bits (145), Expect = 1e-07 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = -3 Query: 142 PLGIL*RFYFVQVYLGYPPRPYFLDPDTGSDLTWLQCD 29 PLG +Y+V + +G PP+PYFLDPDTGSDL+WLQCD Sbjct: 63 PLG----YYYVSLSIGQPPKPYFLDPDTGSDLSWLQCD 96