BLASTX nr result
ID: Scutellaria24_contig00019794
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00019794 (218 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001236373.1| uncharacterized protein LOC100527460 [Glycin... 53 2e-06 ref|XP_002302802.1| predicted protein [Populus trichocarpa] gi|2... 51 2e-06 ref|XP_003626044.1| DnaJ [Medicago truncatula] gi|355501059|gb|A... 56 3e-06 ref|XP_004135355.1| PREDICTED: uncharacterized protein LOC101221... 55 6e-06 >ref|NP_001236373.1| uncharacterized protein LOC100527460 [Glycine max] gi|255632404|gb|ACU16552.1| unknown [Glycine max] Length = 135 Score = 53.1 bits (126), Expect(2) = 2e-06 Identities = 22/32 (68%), Positives = 26/32 (81%) Frame = -3 Query: 216 VKDAYRRKVWETHPDRFPSHLKPQAEFNFKLV 121 VK AY++KVWE+HPD FPSH KP AE FKL+ Sbjct: 23 VKSAYKKKVWESHPDLFPSHEKPLAESKFKLI 54 Score = 23.1 bits (48), Expect(2) = 2e-06 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = -2 Query: 52 ISEAYTLLNSGG 17 ISEAYT L SGG Sbjct: 54 ISEAYTCLESGG 65 >ref|XP_002302802.1| predicted protein [Populus trichocarpa] gi|222844528|gb|EEE82075.1| predicted protein [Populus trichocarpa] Length = 103 Score = 51.2 bits (121), Expect(2) = 2e-06 Identities = 22/32 (68%), Positives = 25/32 (78%) Frame = -3 Query: 216 VKDAYRRKVWETHPDRFPSHLKPQAEFNFKLV 121 VK AYR+KVWE+HPD FP H KP AE FKL+ Sbjct: 23 VKAAYRKKVWESHPDLFPLHEKPGAESKFKLI 54 Score = 25.0 bits (53), Expect(2) = 2e-06 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -2 Query: 52 ISEAYTLLNSGGSTTLF 2 ISEAYT L +G S+ LF Sbjct: 54 ISEAYTYLQTGNSSLLF 70 >ref|XP_003626044.1| DnaJ [Medicago truncatula] gi|355501059|gb|AES82262.1| DnaJ [Medicago truncatula] Length = 70 Score = 55.8 bits (133), Expect = 3e-06 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = -3 Query: 216 VKDAYRRKVWETHPDRFPSHLKPQAEFNFKLVR 118 VK AY++KVWE+HPD FPSH KP AE FKLVR Sbjct: 23 VKSAYKQKVWESHPDLFPSHEKPHAESKFKLVR 55 >ref|XP_004135355.1| PREDICTED: uncharacterized protein LOC101221514 [Cucumis sativus] gi|449503297|ref|XP_004161932.1| PREDICTED: uncharacterized LOC101221514 [Cucumis sativus] Length = 134 Score = 55.1 bits (131), Expect = 6e-06 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = -3 Query: 216 VKDAYRRKVWETHPDRFPSHLKPQAEFNFKLV 121 VK+AY+R VW+THPD FP+H KPQAE FKL+ Sbjct: 23 VKEAYKRMVWDTHPDLFPAHQKPQAESKFKLI 54