BLASTX nr result
ID: Scutellaria24_contig00019523
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00019523 (276 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002310913.1| predicted protein [Populus trichocarpa] gi|2... 67 2e-09 ref|XP_002315361.1| predicted protein [Populus trichocarpa] gi|1... 67 2e-09 ref|XP_002270173.1| PREDICTED: transcription elongation factor S... 65 6e-09 ref|XP_004145631.1| PREDICTED: transcription elongation factor S... 64 2e-08 ref|XP_002513156.1| suppressor of ty, putative [Ricinus communis... 59 3e-07 >ref|XP_002310913.1| predicted protein [Populus trichocarpa] gi|222850733|gb|EEE88280.1| predicted protein [Populus trichocarpa] Length = 116 Score = 66.6 bits (161), Expect = 2e-09 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = -2 Query: 275 VPGCYTLAVSEALPQDLQNICEEEHVPYVPPKQ 177 VPGCYTLAVSEALP+DLQN+CE+E VPY+PPK+ Sbjct: 83 VPGCYTLAVSEALPEDLQNLCEDERVPYIPPKR 115 >ref|XP_002315361.1| predicted protein [Populus trichocarpa] gi|118489920|gb|ABK96757.1| unknown [Populus trichocarpa x Populus deltoides] gi|222864401|gb|EEF01532.1| predicted protein [Populus trichocarpa] Length = 116 Score = 66.6 bits (161), Expect = 2e-09 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = -2 Query: 275 VPGCYTLAVSEALPQDLQNICEEEHVPYVPPKQ 177 VPGCYTLAVSEALP+DLQN+CE+E VPY+PPK+ Sbjct: 83 VPGCYTLAVSEALPEDLQNLCEDERVPYIPPKR 115 >ref|XP_002270173.1| PREDICTED: transcription elongation factor SPT4 homolog 2 [Vitis vinifera] gi|297742714|emb|CBI35348.3| unnamed protein product [Vitis vinifera] Length = 114 Score = 65.1 bits (157), Expect = 6e-09 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -2 Query: 275 VPGCYTLAVSEALPQDLQNICEEEHVPYVPPKQ 177 VPGCYTLAVSEALP+DLQN+CEEE V YVPPK+ Sbjct: 82 VPGCYTLAVSEALPEDLQNLCEEERVQYVPPKR 114 >ref|XP_004145631.1| PREDICTED: transcription elongation factor SPT4 homolog 2-like [Cucumis sativus] Length = 116 Score = 63.5 bits (153), Expect = 2e-08 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -2 Query: 275 VPGCYTLAVSEALPQDLQNICEEEHVPYVPPKQ 177 VPGCYTLAVSEALP+DLQN+CEEE V Y PPK+ Sbjct: 83 VPGCYTLAVSEALPEDLQNLCEEERVQYAPPKR 115 >ref|XP_002513156.1| suppressor of ty, putative [Ricinus communis] gi|223548167|gb|EEF49659.1| suppressor of ty, putative [Ricinus communis] Length = 116 Score = 59.3 bits (142), Expect = 3e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -2 Query: 275 VPGCYTLAVSEALPQDLQNICEEEHVPYVPPKQ 177 VPGCYTLAVSEALP+DLQ +CEEE V Y PPK+ Sbjct: 83 VPGCYTLAVSEALPEDLQALCEEERVQYNPPKR 115