BLASTX nr result
ID: Scutellaria24_contig00019489
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00019489 (330 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002540307.1| hypothetical protein RCOM_2083150 [Ricinus c... 55 5e-06 >ref|XP_002540307.1| hypothetical protein RCOM_2083150 [Ricinus communis] gi|223496923|gb|EEF22076.1| hypothetical protein RCOM_2083150 [Ricinus communis] Length = 64 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +1 Query: 1 YLKKLVEFEVEGAKKLLDGLERGKLWGVFGR 93 +LKKLVE +VEGAKKLLDGL RGK+WGVF R Sbjct: 33 HLKKLVEMDVEGAKKLLDGLGRGKIWGVFAR 63