BLASTX nr result
ID: Scutellaria24_contig00019447
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00019447 (330 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADI17229.1| hypothetical protein [uncultured alpha proteobact... 108 3e-22 ref|YP_001949470.1| hypothetical protein BMULJ_05092 [Burkholder... 61 8e-14 emb|CBS90411.1| protein of unknown function [Azospirillum lipofe... 50 5e-09 gb|ADI17560.1| hypothetical protein [uncultured alpha proteobact... 50 7e-07 ref|ZP_21730107.1| hypothetical protein HALTITAN_3297 [Halomonas... 58 7e-07 >gb|ADI17229.1| hypothetical protein [uncultured alpha proteobacterium HF0070_14E07] Length = 139 Score = 108 bits (271), Expect = 3e-22 Identities = 56/98 (57%), Positives = 62/98 (63%) Frame = -2 Query: 329 WTFGDTVFHSVCRYSCQHSHF*YLQALSRVALRRLTEXXXXXXXXXXXXXXXARGLSPVT 150 W +G++V H++CRYSCQHSHF YLQ S+ L GLSP T Sbjct: 44 WAYGESVSHTLCRYSCQHSHFRYLQHPSQDTFTGLRNAPLPCVKDTSSASVY--GLSPDT 101 Query: 149 SSAQKPLFRPVSCYAFFKGWLLLSQPPGCFSLPTSFPT 36 SSAQ L RPVS YAFFKGWLLLSQPPGC LPTSFPT Sbjct: 102 SSAQAGLSRPVSYYAFFKGWLLLSQPPGCLGLPTSFPT 139 >ref|YP_001949470.1| hypothetical protein BMULJ_05092 [Burkholderia multivorans ATCC 17616] gi|189337865|dbj|BAG46934.1| hypothetical protein BMULJ_05092 [Burkholderia multivorans ATCC 17616] Length = 123 Score = 60.8 bits (146), Expect(2) = 8e-14 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = -2 Query: 125 RPVSCYAFFKGWLLLSQPPGCFSLPTSFPT 36 R VS YAFFKGWLLLSQPP CFSLPTSFPT Sbjct: 94 RSVSYYAFFKGWLLLSQPPDCFSLPTSFPT 123 Score = 40.8 bits (94), Expect(2) = 8e-14 Identities = 26/64 (40%), Positives = 32/64 (50%) Frame = -3 Query: 328 GLSATLSFTVFVVTHASIRTSDTSRRSHESPFAGLQNAPLPRSPCGLHPKLRLVA*APLH 149 GL+A FT F+ TH SIRTSDTS +++P L C + APLH Sbjct: 30 GLTARGPFTPFIATHVSIRTSDTSSTLYKAPSQAY--GTLSYHACKHASAASVYGLAPLH 87 Query: 148 LRRR 137 L RR Sbjct: 88 LPRR 91 >emb|CBS90411.1| protein of unknown function [Azospirillum lipoferum 4B] Length = 61 Score = 50.1 bits (118), Expect(2) = 5e-09 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = -1 Query: 237 PSQAYRTLRYRVALADYTLSFGSWLEPRYIFGAETL 130 PSQAY TLRYRV + D+T SFG+ LEPRYIFGA L Sbjct: 26 PSQAYGTLRYRV-IEDHTRSFGTRLEPRYIFGAGRL 60 Score = 35.4 bits (80), Expect(2) = 5e-09 Identities = 16/23 (69%), Positives = 17/23 (73%) Frame = -3 Query: 304 TVFVVTHASIRTSDTSRRSHESP 236 T+FV TH SI TSDTSRR H P Sbjct: 4 TLFVATHVSILTSDTSRRPHGHP 26 >gb|ADI17560.1| hypothetical protein [uncultured alpha proteobacterium HF0130_06E21] Length = 62 Score = 49.7 bits (117), Expect(2) = 7e-07 Identities = 20/29 (68%), Positives = 25/29 (86%) Frame = -2 Query: 329 WTFGDTVFHSVCRYSCQHSHF*YLQALSR 243 WT+G++V H++ RYSCQHSHF YLQ LSR Sbjct: 6 WTYGESVSHTLYRYSCQHSHFRYLQHLSR 34 Score = 28.5 bits (62), Expect(2) = 7e-07 Identities = 14/26 (53%), Positives = 18/26 (69%), Gaps = 2/26 (7%) Frame = -3 Query: 235 FAGLQNAPLPRSPCG--LHPKLRLVA 164 FAGL+NAPLPR+ HP+ R +A Sbjct: 37 FAGLRNAPLPRTSSVEIAHPQFRWIA 62 >ref|ZP_21730107.1| hypothetical protein HALTITAN_3297 [Halomonas titanicae BH1] gi|445563933|gb|ELY20072.1| hypothetical protein HALTITAN_3297 [Halomonas titanicae BH1] Length = 98 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = -2 Query: 125 RPVSCYAFFKGWLLLSQPPGCFSLPTSFPT 36 R VS YAFFKGWLLLSQPP C SLPTSFPT Sbjct: 69 RLVSYYAFFKGWLLLSQPPSCLSLPTSFPT 98