BLASTX nr result
ID: Scutellaria24_contig00018942
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00018942 (834 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528212.1| conserved hypothetical protein [Ricinus comm... 59 1e-06 >ref|XP_002528212.1| conserved hypothetical protein [Ricinus communis] gi|223532373|gb|EEF34169.1| conserved hypothetical protein [Ricinus communis] Length = 271 Score = 59.3 bits (142), Expect = 1e-06 Identities = 31/79 (39%), Positives = 41/79 (51%), Gaps = 3/79 (3%) Frame = -1 Query: 231 GAVSTHLLLEWNNSSPFAIFDFCIYSIPFC*---RLYCIDCLTYILTEFVIGKQSGCCKP 61 G S L NN+ + C+ C + Y D LT + T + QSGCCKP Sbjct: 116 GDYSNWLQKRVNNTKNWNKIKSCLADSKVCSDFNQKYLNDTLTILYTRHLSAVQSGCCKP 175 Query: 60 SNDCNFQYVSPTNWTEGTT 4 +++C +QYVSPTNWT G T Sbjct: 176 ADECAYQYVSPTNWTPGAT 194