BLASTX nr result
ID: Scutellaria24_contig00018906
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00018906 (606 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI21459.3| unnamed protein product [Vitis vinifera] 71 2e-10 ref|YP_358581.1| hypothetical protein PhapfoPp032 [Phalaenopsis ... 64 2e-09 gb|AFW62558.1| hypothetical protein ZEAMMB73_716887 [Zea mays] 61 2e-07 >emb|CBI21459.3| unnamed protein product [Vitis vinifera] Length = 79 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = -2 Query: 605 RTRTVDFLGKTDQTYYYQNDLNCFKDPTCIFVCIGLF 495 RTRTVD LGKTDQT YYQNDLNCFKDPTCIF +G F Sbjct: 41 RTRTVDLLGKTDQTDYYQNDLNCFKDPTCIFFALGSF 77 >ref|YP_358581.1| hypothetical protein PhapfoPp032 [Phalaenopsis aphrodite subsp. formosana] gi|58802836|gb|AAW82556.1| hypothetical protein [Phalaenopsis aphrodite subsp. formosana] Length = 103 Score = 63.9 bits (154), Expect(2) = 2e-09 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -2 Query: 605 RTRTVDFLGKTDQTYYYQNDLNCFKDPTCIFV 510 RTRTVD LGKT++TYYY+NDLNCFKDPTCI + Sbjct: 60 RTRTVDLLGKTEKTYYYRNDLNCFKDPTCILL 91 Score = 23.5 bits (49), Expect(2) = 2e-09 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = -1 Query: 510 LHWALSLTDRNIS 472 LHWALS TD IS Sbjct: 91 LHWALSSTDVKIS 103 >gb|AFW62558.1| hypothetical protein ZEAMMB73_716887 [Zea mays] Length = 53 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -2 Query: 605 RTRTVDFLGKTDQTYYYQNDLNCFKDPTCIFV 510 R RTVD LGKTDQT YY+ND NCFKDPTCIF+ Sbjct: 10 RIRTVDLLGKTDQTDYYRNDSNCFKDPTCIFL 41