BLASTX nr result
ID: Scutellaria24_contig00018815
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00018815 (481 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513467.1| ubiquitin-protein ligase, putative [Ricinus ... 58 7e-07 >ref|XP_002513467.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223547375|gb|EEF48870.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 464 Score = 58.2 bits (139), Expect = 7e-07 Identities = 37/123 (30%), Positives = 63/123 (51%), Gaps = 2/123 (1%) Frame = -2 Query: 480 LSASPCLERFVLEVLRSNPDFDEKNTQKVVSSYSH--LKEFMFVGYYGMMSDLEFVMHFV 307 L P L RF L+V+ + +QKV +SH LK +G+ G +++E V++F+ Sbjct: 349 LKGCPLLHRFTLKVISCESTLVCRASQKVPEDHSHPCLKVVEVLGFQGNAAEVELVLYFL 408 Query: 306 ENAVALETVVVDPCEPCESTYHYVYRYKSELKGEIIEKEINARARAKKQLTKFMPPSINL 127 NA L+ +++ PC PC R S+LK + E +A+ A +L +PP ++ Sbjct: 409 RNAAVLKNLIISPCAPC------YLRSPSQLKFKETELYQSAKQHA-VELGARVPPGVDF 461 Query: 126 HIL 118 +L Sbjct: 462 VVL 464