BLASTX nr result
ID: Scutellaria24_contig00018561
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00018561 (339 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517964.1| Indole-3-acetic acid-amido synthetase GH3.5,... 55 4e-06 >ref|XP_002517964.1| Indole-3-acetic acid-amido synthetase GH3.5, putative [Ricinus communis] gi|223542946|gb|EEF44482.1| Indole-3-acetic acid-amido synthetase GH3.5, putative [Ricinus communis] Length = 600 Score = 55.5 bits (132), Expect = 4e-06 Identities = 30/63 (47%), Positives = 38/63 (60%), Gaps = 2/63 (3%) Frame = -3 Query: 184 SSD*PAMSTCRSNGGCS--DIVSWFDXXXXXXXXXXXXTLRRILEQNSGVEYLKKWLGNM 11 S+ P+ + +NG CS DI+ WFD TLRRILE N GVEYLKKWLG++ Sbjct: 3 STSSPSSNGNGNNGHCSSYDIIRWFDDVSENAGKVQTGTLRRILELNCGVEYLKKWLGDI 62 Query: 10 NVQ 2 +Q Sbjct: 63 KIQ 65